KEGG   Methanospirillum hungatei: Mhun_1123Help
Entry
Mhun_1123         CDS       T00325                                 

Definition
(GenBank) 2,3-di-O-geranylgeranylglyceryl phosphate reductase
  KO
K17830  digeranylgeranylglycerophospholipid reductase [EC:1.3.1.101 1.3.7.11]
Organism
mhu  Methanospirillum hungatei
Pathway
mhu00564  Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:mhu00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    Mhun_1123
Enzymes [BR:mhu01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.101  2,3-bis-O-geranylgeranyl-sn-glycerol 1-phosphate reductase [NAD(P)H]
     Mhun_1123
   1.3.7  With an iron-sulfur protein as acceptor
    1.3.7.11  2,3-bis-O-geranylgeranyl-sn-glycero-phospholipid reductase
     Mhun_1123
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_3 FAD_binding_2 FAD_oxidored HI0933_like NAD_binding_8 Pyr_redox_2 DAO GIDA Thi4 Pyr_redox
Motif
Other DBs
NCBI-ProteinID: ABD40872
UniProt: Q2FUA4
Position
complement(1268407..1269615)
Genome map
AA seq 402 aa AA seqDB search
MKREYDVLVVGGGPGGAFAAKTFAEKGYSVLLTEKRPAIGAPVRCAEGVGKALMHEFFKP
EDRWVAAEIEKANIIAPDGFKMELEPEKAGAEVGYVLHRKVFDRDLVWMAAGAGADIQVK
TRAVTPIMEDGAVKGAILNQGGIAQEVRAGLTIAADGVESKFARWCGVDTTVPLREMETC
AQYLMTGIDIDAHATEFYVGNNIAPGGYVWIFPKGDKTANVGIGVGGDRCKPGNRPIDYL
NRFVARNFPNGKTIELIAGGVSICQPLPCTVANNLMIVGDAARVSDPLTGGGIYAALYTG
KLAGDVGSKAIEKGDTSTQALMPYDETWRASYLGKALERNYQIKEVFVKLNDDDLNAIVH
SVSKMNLSDFNTLNLIKNIIAANPKLAIKLGKAGLKSLLDSF
NT seq 1209 nt NT seq  +upstreamnt  +downstreamnt
atgaagcgcgagtatgatgttctcgtagtgggaggaggtcctggcggagcatttgctgca
aagacctttgccgagaaggggtattctgtcctgctcactgagaaacgccctgccattggt
gctccggtcagatgtgccgaaggagtcggaaaagccctgatgcatgagttcttcaagcct
gaagaccggtgggttgcagcagagattgagaaggccaatatcatagcacctgacgggttt
aagatggaacttgaaccggaaaaggcaggagcagaggtcggctatgttctgcaccgcaag
gtatttgatcgggaccttgtctggatggcagccggagcaggagcagacatccaggttaag
acccgtgcagttaccccaatcatggaggatggagcggtaaagggtgctattcttaatcag
ggaggcattgctcaagaagtaagggcaggacttaccattgcagcagacggtgttgagtca
aagtttgcacgctggtgcggtgttgacacaacggtccctcttcgtgagatggagacctgt
gcccagtatctgatgaccgggattgacatcgatgctcatgcaaccgagttctacgtgggt
aacaacatcgctccaggtggctatgtatggatatttccaaaaggtgacaaaaccgctaac
gtgggtattggtgtcggtggagaccggtgcaaaccaggaaatcggccgattgactacctg
aatcgtttcgtcgccaggaattttcccaatggtaagaccatcgagctgatagccggcggt
gtctctatctgtcagccactcccatgcacagttgcaaacaacctcatgatcgtcggtgat
gcagcccgtgtgtctgatcctctcaccggtggtggtatctatgccgctctctataccgga
aaacttgccggagatgttggatccaaggctattgaaaaaggcgatacatctactcaggca
ctcatgccctatgacgagacatggagagcatcgtatcttggaaaggcgcttgagagaaat
taccagattaaagaggtattcgtcaaattgaatgatgatgacctgaatgcaattgtgcac
tcagtctcaaaaatgaacctttcagatttcaataccttaaatcttataaaaaatatcatc
gcagcaaatcccaagcttgcaataaaacttgggaaagcaggtctgaagtcacttcttgac
tcattctga

DBGET integrated database retrieval system