KEGG   Methanospirillum hungatei: Mhun_1790Help
Entry
Mhun_1790         CDS       T00325                                 

Definition
(GenBank) tryptophan synthase, beta chain
  KO
K01696  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
mhu  Methanospirillum hungatei
Pathway
mhu00260  Glycine, serine and threonine metabolism
mhu00400  Phenylalanine, tyrosine and tryptophan biosynthesis
mhu01100  Metabolic pathways
mhu01110  Biosynthesis of secondary metabolites
mhu01130  Biosynthesis of antibiotics
mhu01230  Biosynthesis of amino acids
Module
mhu_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:mhu00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Mhun_1790
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Mhun_1790
Enzymes [BR:mhu01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Mhun_1790
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: ABD41511
UniProt: Q2FKX7
Position
2022632..2023807
Genome map
AA seq 391 aa AA seqDB search
MQLNTRLGEYGGCFVPETLMGALEELEDAFLKIFPGSAFQKELSKYLTTYAGRETPLTFC
NNMSRDLGCRVYLKREDLLHSGAHKMNNALGQALLAKYMGKKRLIAETGAGQHGVATAIA
GAVLGLEVDVFMGEVDIARQALNVARMNMMGARVIPVTCGTRTLKDAMNEALRDWVARVL
DTHYLIGTVAGPHPYPTLVRDLQRVIGDETKKQILAAEGRLPDVIIACIGGGSNAIGIFH
PFIEDKAVRMYGVEAGGEGLDRKHGASLCGGRPGVLHGNYSYLLQDAFGQIIESHSISAG
LDYPGVGPEHAMHKDSGRITYTAITDTEALEAFLYLCRTEGIVPALESSHAVAFARKLAP
DLSEDTIIVINLSGRGDKDVETVRRYMEGKQ
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atgcagcttaatacccgacttggggagtacggcggatgctttgtccctgaaaccctcatg
ggagccctggaagaactggaagatgcattcctgaagatcttcccgggatcggcctttcaa
aaagaactcagcaagtacctgacaacctacgccggacgggaaacccccctgaccttctgt
aacaacatgtcacgggatctcggatgcagggtgtacctgaagcgcgaggatctcctccat
tcaggggcccataagatgaacaatgccctgggtcaggcactactcgcaaaatatatgggt
aaaaaacggcttattgcagagaccggtgcaggacagcacggagttgcaaccgccatcgcc
ggagcggtccttggccttgaggttgacgtgttcatgggtgaagtggacattgcccgccag
gccctcaatgttgccaggatgaatatgatgggagcacgggtcatcccggtcacatgcggg
acccggacactcaaggacgccatgaatgaagcactccgggactgggttgcccgcgttctt
gacacccattatctcataggaacggtcgccggaccacacccctaccctactctggtcaga
gacctgcaacgggtcatcggtgatgagacaaaaaagcagattctggcagcagaaggaagg
cttcctgatgtcatcatcgcctgtatcgggggaggatccaatgccatcgggatctttcat
ccgttcatcgaagataaggcagtcaggatgtacggggttgaggcaggcggagaggggctt
gaccggaaacatggcgcttcactctgcggaggaagaccgggtgtgctccacgggaactat
tcctaccttctacaggatgcattcggccagataattgagtcacactccatatcagccggg
cttgactaccctggtgtcgggcctgaacatgcgatgcataaggattcaggcaggattaca
tacacggcaattaccgacaccgaagcacttgaggccttcctgtacctctgtcggacggag
gggattgttccggcactggagtcctcacatgccgttgcatttgcacgaaaactggcaccg
gatctctcagaagataccatcattgtaatcaacctctccggacggggagacaaggatgtt
gaaaccgttcgaaggtacatggagggcaagcaatga

DBGET integrated database retrieval system