KEGG   Methanospirillum hungatei: Mhun_2262Help
Entry
Mhun_2262         CDS       T00325                                 

Definition
(GenBank) AMP phosphorylase
  KO
K18931  AMP phosphorylase [EC:2.4.2.57]
Organism
mhu  Methanospirillum hungatei
Brite
Enzymes [BR:mhu01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.57  AMP phosphorylase
     Mhun_2262
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glycos_transf_3 Glycos_trans_3N PYNP_C DUF2254 Molydop_binding XkdW
Motif
Other DBs
NCBI-ProteinID: ABD41967
UniProt: Q2FTS5
Position
complement(2523741..2525291)
Genome map
AA seq 516 aa AA seqDB search
MRLTVRLVDIAARGILLHHNDAKSLGVLAGDRIVISSPVTGKATVDYVETTGTLIDQGRI
GVYHHTNEQLTLTENEVVEVRVADRPVSLDYIKKKMEGEKLTREDIRAIVADIVQDTLSP
SEITAFVVSSYINQLDMDEIESLTRAMVETGDQLSFHAGPIVDKHSIGGVPGNKISLIVV
PIIAASGLLIPKTSSRAITGAGGTADLMEVLAPVEFSASEVQEMTIKTGGVIVWGGATNI
APADDKIIIQEYPFKIDQIGQMIASVMAKKFAVGADVVAIDIPVGKYCKVHTIEEGKKLA
RQFIDLGERLNMRVECALTYGDAPVGRAIGPKLEIKEALSVLEGSDSPRSLIQKSCVIAG
IALELAGKANRGEGANLALEILRSGKALKKFLDIIAVQGGTPDVSSEKITVGEHFYTVRA
DSTGYVIDLNNHSLITIARTAGAPADHGAGLYLHAKHGTSLSKGDPIFTIYADRKWRLEK
AIEEARRLRPVMVEGMLIDRVPNVREWVPGRSRNLE
NT seq 1551 nt NT seq  +upstreamnt  +downstreamnt
atgagacttaccgtccgactggtggatattgctgcacggggaattctcttacatcataat
gatgcaaaatcactcggagtgcttgcgggtgaccggattgtcatctcttctcctgttacc
ggcaaggctaccgtagattatgtggagacaactggcactcttatcgaccagggccgtatt
ggcgtgtaccatcacacgaatgagcaactgacccttaccgaaaatgaggttgtcgaggtc
agggttgcagaccgtccggtttctcttgattatataaaaaagaagatggaaggagagaaa
ctgacccgtgaggatatcagggctattgttgctgatattgttcaggatacactctccccg
agtgaaattaccgcttttgttgtaagttcctatatcaatcaactggacatggatgagatt
gagtcacttacccgtgccatggttgagacaggtgaccagctctcattccatgccggacca
atcgtcgataaacattcaatcgggggtgtgccgggcaataagatatcacttattgtcgtt
cccattattgctgcaagcggtcttttaattcccaagaccagttcacgggcaattaccgga
gcaggagggacagcagatcttatggaggttcttgccccggttgaatttagtgcatcagaa
gttcaggagatgaccataaagaccggtggggtgattgtctggggaggtgccacgaatatt
gcacctgctgatgataagatcatcattcaggagtacccttttaagattgatcagatcggt
cagatgattgcaagtgttatggccaaaaaatttgcagtaggtgcagatgtcgttgccatc
gacataccggtcggaaaatactgcaaggtgcataccatagaagaagggaaaaaacttgca
cggcagttcattgatcttggagaacggctcaatatgcgggttgagtgtgctctgacttac
ggtgatgccccggttggccgggcgattgggccgaagctggagattaaggaggcactcagt
gttctggaaggaagtgattccccccggtcactcattcagaagagctgtgtaattgcgggt
attgcgctggaacttgcaggaaaagcaaaccgtggtgagggggcaaaccttgcccttgag
atactgcggtcaggaaaggcactcaaaaaattccttgatatcatcgcagttcagggtgga
acacctgatgtaagttcggaaaaaataacggtgggagagcatttctacacggtccgtgca
gacagtaccgggtatgttattgatctgaacaaccattccctgataacaattgcacggacc
gcaggtgcgccagcagatcatggagcagggctctatcttcatgctaaacatggcaccagc
ctctccaagggtgaccccatcttcacgatctatgcagaccggaaatggcggcttgaaaaa
gcaattgaggaagcacgaagactcaggccggttatggttgagggtatgctaatcgaccgt
gtccccaatgtcagagagtgggtacccgggagatccagaaatcttgaataa

DBGET integrated database retrieval system