KEGG   Mycoplasma hyorhinis DBS 1050: Q453_0068Help
Entry
Q453_0068         CDS       T02927                                 

Definition
(GenBank) dihydrofolate reductase family protein
  KO
K00287  dihydrofolate reductase [EC:1.5.1.3]
Organism
mhv  Mycoplasma hyorhinis DBS 1050
Pathway
mhv00670  One carbon pool by folate
mhv00790  Folate biosynthesis
mhv01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mhv00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Q453_0068
   00670 One carbon pool by folate
    Q453_0068
Enzymes [BR:mhv01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     Q453_0068
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DHFR_1
Motif
Other DBs
NCBI-ProteinID: AHA40822
Position
79485..79988
Genome map
AA seq 167 aa AA seqDB search
MIISILAMGKNNLIGKGDDLPWYVKEDFDFYREQTKHHDILVGKNTFFTLPKSLQKWSKI
YIVSDDKNFNYENENVKTINNFSNLIKEYQNHPSKHLFVSGGYTLYKSIINKCDQLIISF
IKGEHSGDIFLNELKWEKFEEISSKDKGKFIVKNIKRQSNLIKFFLV
NT seq 504 nt NT seq  +upstreamnt  +downstreamnt
atgataatttcaattttagccatgggcaaaaataatttaataggaaaaggcgatgattta
ccttggtatgtaaaagaagactttgatttttatagagaacaaacaaaacatcatgatatt
ttagtaggaaaaaatactttctttactttaccaaaatcacttcaaaaatgaagcaaaatt
tatattgttagtgatgataaaaattttaattacgaaaatgaaaatgtgaaaacaataaat
aatttttctaatctaattaaagaatatcaaaatcatcctagtaaacatttgtttgtttca
ggaggatatactttgtacaaaagcattataaataagtgtgatcaattaataatttccttt
atcaagggagaacactctggtgatatttttttaaatgaactaaaatgagaaaaatttgaa
gaaatttcttcaaaagataaaggaaaatttatagtaaaaaatataaaaagacaaagtaat
ttgataaaattttttttggtttaa

DBGET integrated database retrieval system