KEGG   Megasphaera hexanoica: ACT01_03205Help
Entry
ACT01_03205       CDS       T05536                                 

Definition
(GenBank) methionine--tRNA ligase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
mhw  Megasphaera hexanoica
Pathway
mhw00450  Selenocompound metabolism
mhw00970  Aminoacyl-tRNA biosynthesis
mhw01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mhw00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    ACT01_03205
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    ACT01_03205
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:mhw01007]
    ACT01_03205
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:mhw03016]
    ACT01_03205
Enzymes [BR:mhw01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     ACT01_03205
Amino acid related enzymes [BR:mhw01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   ACT01_03205
Transfer RNA biogenesis [BR:mhw03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    ACT01_03205
 Prokaryotic type
   Other AARSs
    ACT01_03205
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1 tRNA_bind tRNA-synt_1e Anticodon_1 tRNA-synt_1f
Motif
Other DBs
NCBI-ProteinID: AXB81323
UniProt: A0A344MHD4
Position
695586..697523
Genome map
AA seq 645 aa AA seqDB search
MTDKKKYFITTPIYYPSAKLHIGHTYCTTIADTLARFHRLRGDDVFFTTGSDEHGQKIQR
AAESKGMQPKEYVDGIVALFKELWKELNISHDRFIRTTDADHVKVTQALMQKSYDKGDIY
KGEYKGWYCTPCESFWPENKLPEGKHICPDCGRPLELVSEEAYFLKMSNYTDRWLKFIDE
NPDFIQPEARRNEMIAFVKSGLEDLCVSRTSFNWGIPVPWDPKHVVYVWYDALANYLTSA
GYVFDEERFKKWWPADLHLVGKEIVRFHSIIWPIMLMSAGLPLPKKVFGHGWLIVDGTKM
SKSLGNVVDPIPLIKRYGADSLRYYLMREIRLGQDGNFSLPTFIDRINADLANDLGNLLH
RTLAMVEQYENGVAAGPSAAEPVDSELSQMAVETAKKYEQQMDDMKINDALNDTWALIHR
SNKYIDETTPWILAKDPAKKERLQTVLYNLLEVQRIIAMLVSPVIPSAAAEIWKQLGLGD
FSQAILADGQTWGLYPAGTKVCKGAPLFPRYDPKEEIAEAEEEKKAAAACPAAKEPFKDE
INIDDFGKNDLRVGKIVACEKVPKAKKLLKIQVDLGTETRQIVSGISLYYKPEDLIGHNV
IVVTNLKPVKLCGVESKGMLLAASDGNDHLQVVFVDGMAPGSRVR
NT seq 1938 nt NT seq  +upstreamnt  +downstreamnt
atgacagacaagaagaagtattttattaccaccccgatttattatccgagtgccaagctg
catatcggtcacacgtactgcacgactattgccgacacactggcccggttccatcgtctc
cgcggcgatgacgtcttttttactactggatccgatgaacatggtcagaaaatccagcgt
gccgctgaaagcaagggaatgcagcctaaggaatatgttgacggcatcgtggctcttttc
aaagaactctggaaagaactgaacatttcccatgaccgctttatccgtacgactgatgcc
gatcatgtcaaagtgacgcaggccctgatgcagaaatcctatgacaagggagatatttat
aaaggagaatacaaaggctggtactgcactccctgtgaatcgttctggccggaaaacaaa
ctgcccgaaggcaaacacatctgcccggattgcggccgcccgctggaactcgtttcggaa
gaagcttatttcctcaagatgagcaattatacggaccgctggttgaagttcatcgatgaa
aaccctgatttcattcagccggaagcccgccgcaatgaaatgattgcctttgtcaaaagc
ggtctggaagatttgtgcgtatcccgtacatcctttaactgggggattcccgtaccctgg
gatccgaaacatgtcgtatacgtctggtatgatgccctggctaactacctgacttcagct
ggctatgtatttgatgaagaacgcttcaaaaaatggtggccggcagatcttcatctggtc
ggcaaggaaattgtacggttccattcgattatatggcccattatgctgatgagtgccggt
ctgccactgcctaaaaaagtattcggtcacggctggctgattgtcgatgggacgaagatg
agtaaatccctgggcaatgtcgtcgatccgattccactgattaaacgctatggcgccgat
tcactccggtattatctgatgcgtgaaatccgtctcggtcaggatggcaacttctctctg
ccgacctttatcgaccggatcaatgccgatctggccaatgacctgggcaatcttctccat
cgtacgctggctatggttgaacagtatgaaaacggagtggcagccggtccttcggctgca
gaaccggtggacagcgaattgtcccagatggccgtagaaactgctaaaaaatacgaacag
cagatggatgacatgaagattaatgacgcccttaacgatacatgggctctgatccatcgc
agcaataaatatatcgatgaaacgacaccgtggattctcgccaaagacccggctaaaaaa
gaacgcctccagactgttctgtacaatctcctggaagtacagcgtatcattgccatgctg
gtaagcccggtcatcccgtcggcggctgctgaaatatggaaacagctggggctgggtgat
ttctcccaggcaattttggcagatggacagacttggggcctgtatccggccggtacgaaa
gtttgcaaaggagcacctttgttccctcggtatgatccgaaagaagaaattgctgaagcg
gaagaagaaaagaaagcggccgctgcctgccctgcagcaaaagaaccgttcaaagatgaa
atcaacattgatgatttcggcaaaaatgatctccgcgtcggcaaaattgtagcctgtgaa
aaagtaccgaaagccaaaaaacttctcaaaatccaggttgatctgggtacagaaacccgt
cagattgtcagtggtatttctctgtattataagccggaagacctgattggtcataatgtt
attgtcgtgacgaatctgaaaccggttaagctgtgtggtgtagaatcgaaagggatgctg
ctggcagcatcggatggcaacgatcatctgcaggtcgtctttgtcgatggcatggcaccg
ggaagccgcgtccgctga

DBGET integrated database retrieval system