KEGG   Megasphaera hexanoica: ACT01_05115Help
Entry
ACT01_05115       CDS       T05536                                 

Definition
(GenBank) alcohol dehydrogenase
  KO
K00005  glycerol dehydrogenase [EC:1.1.1.6]
Organism
mhw  Megasphaera hexanoica
Pathway
mhw00561  Glycerolipid metabolism
mhw00640  Propanoate metabolism
mhw01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mhw00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    ACT01_05115
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    ACT01_05115
Enzymes [BR:mhw01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.6  glycerol dehydrogenase
     ACT01_05115
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fe-ADH Fe-ADH_2 DHQ_synthase
Motif
Other DBs
NCBI-ProteinID: AXB81666
UniProt: A0A344MIC7
Position
1094209..1095306
Genome map
AA seq 365 aa AA seqDB search
MAVVLRDVGQYIQGAGELDNLGKFVKKLGNKFLLICSPNNKQRIGDRIETALNSVEKEIV
YSEFHNQCTMEAIEKAVADGTAAGCDIIIGAGGGTAIDTAKAVATKMGGIPCVIIPTIAS
NDAPCAGLSVVYNEEGVVVKVINMVRNPDVVLVDTGVIAQAPRKFLVSGMGDALATYFEA
RACWRTGARTMARGNCSHTSLAMAKLCYDLLLEHSVKALEAVDRNEVNEDLENVVEACIY
LSGFGAICGGLAAAHAINDGLGAVPQIHANGTSHGEKVAFGLIAQLILEKAPEEEWNTVL
DYIHAVGLPSTLADLGVTEFVEADIRRAAKIAASPKEFTKNVRADITADEVYEAILAADK
AGAAK
NT seq 1098 nt NT seq  +upstreamnt  +downstreamnt
atggcagtagtactcagagacgtaggacagtatattcagggcgcaggtgaactcgataac
ctgggaaaattcgtaaaaaaactgggcaataaattcttgctcatctgttcccccaataat
aaacagcgtattggcgaccgcatcgaaacggcattgaatagtgtagaaaaggaaatagtc
tattccgaattccacaatcagtgcaccatggaagccatcgaaaaggccgtagccgacgga
acggctgccggctgtgacatcatcatcggtgccggcggcggcacggctatcgatacggcc
aaagccgtggcaaccaaaatgggcggcatcccctgtgtcatcatcccgaccatcgcatcc
aacgatgcaccctgtgccggcctttccgtcgtctacaatgaagaaggcgtcgtcgtcaaa
gtcatcaatatggtccgcaaccccgacgtcgttctcgtcgatacgggcgtcattgcccag
gcaccgcgcaaattcctcgtatccggcatgggcgatgccctggctacgtattttgaagcc
cgcgcctgctggcgtaccggtgcccgcaccatggcacggggcaactgctcccacacgtca
ctggctatggccaagctctgctatgacctcctcctcgaacattccgtcaaggctctggaa
gcggtagaccgcaacgaagtgaacgaagacctggaaaacgtcgtcgaagcctgcatttac
ctcagcggattcggcgctatctgcggcggtctggctgctgcccatgccatcaatgacggc
ctcggtgccgtaccgcagattcatgccaacggcacgtcccacggcgaaaaagtcgccttt
ggcctcatcgcccagctcatcctcgaaaaagctccggaagaagaatggaataccgtcctc
gactatatccacgccgtcggcctgccgtccacactggctgatctgggcgtaacggaattt
gtcgaagccgacatccgccgggctgctaaaatcgccgcatcgccgaaagaattcaccaaa
aacgtccgcgccgacatcactgccgatgaagtctatgaagccatcctggctgccgataaa
gccggcgctgccaaataa

DBGET integrated database retrieval system