KEGG   Megasphaera hexanoica: ACT01_07380Help
Entry
ACT01_07380       CDS       T05536                                 

Definition
(GenBank) inorganic phosphate transporter
  KO
K03306  inorganic phosphate transporter, PiT family
Organism
mhw  Megasphaera hexanoica
Brite
KEGG Orthology (KO) [BR:mhw00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    ACT01_07380
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4
Motif
Other DBs
NCBI-ProteinID: AXB82071
UniProt: A0A344MJI2
Position
complement(1585600..1586604)
Genome map
AA seq 334 aa AA seqDB search
MLDTYMIILVVVLALIFDFINGFHDTANAIATCVSTRAIRPGLAIIGTAILNFIGAMIST
GVAKTIGGDIVISASMINELIIVSGLTGAIIWNLLTWYVGMPSSSSHALIGGMIGAVAIS
VGFGALNGWGILKIFLSLILSPITAIVVGYIIMNLLFAFCHNYRPAVVNLTANRLQILSA
ALMAFSHGSNDAQKSMGIITLALLSGGFIETLEVPTIVKLLCAAAMALGTSVGGWKIIRT
VGGKIFKMHPIHGFAADLNSAVVIFTATLLHLPVSTTHVVSGSIMGVGAAQRVKAVHWNV
ARQMVSAWVLTIPCTAVMGALAFLIIRYVFFAVV
NT seq 1005 nt NT seq  +upstreamnt  +downstreamnt
atgcttgatacgtacatgattatcctcgtcgtcgttctggccctgatttttgatttcatc
aacggcttccacgatacagccaatgccatcgctacctgcgtatcgacacgggcaatccgg
cccggcctggctatcatcggtacggctatcctgaactttatcggtgccatgatttctaca
ggcgttgccaaaacgattggcggcgatatcgtcatatcggccagtatgatcaatgaactg
attatcgtgtccggcctgacaggagccatcatatggaatctcctgacctggtacgtcggc
atgccgtccagctcttctcacgctcttataggcggcatgattggcgccgttgccatttct
gtcggtttcggtgccctcaacggttggggcatattgaagattttcctctcccttatcctg
tctcctataaccgccatcgtcgtcggttatattattatgaatctcctctttgccttctgc
cataattaccgtccggccgtcgtcaacctgacggccaacaggctgcagatcctgtccgct
gctctcatggccttttcccacggatccaatgatgcccagaaatcgatggggatcattaca
ctggccctgctttctggcggattcatcgaaacactggaagttcctactatcgtcaaactg
ctctgcgctgccgccatggccctgggaaccagtgtaggcggctggaaaatcatccgtacg
gtaggcggcaaaattttcaagatgcatcccatccacggatttgctgccgatctcaactcg
gcagttgttatctttacggccacgctgcttcacctgcccgtatcgacgacccatgtcgta
tccggatctatcatgggtgtgggcgctgcccagcgcgttaaagccgttcactggaacgta
gcgcgccagatggtttctgcctgggtccttaccatcccctgcacggccgtcatgggagca
ctcgccttcctcatcatccgttatgtcttctttgccgtcgtctaa

DBGET integrated database retrieval system