KEGG   Mannheimia haemolytica M42548: MHH_c04350Help
Entry
MHH_c04350        CDS       T02635                                 

Gene name
rplV
Definition
(GenBank) 50S ribosomal protein L22
  KO
K02890  large subunit ribosomal protein L22
Organism
mhx  Mannheimia haemolytica M42548
Pathway
mhx03010  Ribosome
Brite
KEGG Orthology (KO) [BR:mhx00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    MHH_c04350 (rplV)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:mhx03011]
    MHH_c04350 (rplV)
Ribosome [BR:mhx03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    MHH_c04350 (rplV)
  Bacteria
    MHH_c04350 (rplV)
  Archaea
    MHH_c04350 (rplV)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L22
Motif
Other DBs
NCBI-ProteinID: AGK00922
Position
complement(399064..399396)
Genome map
AA seq 110 aa AA seqDB search
METIAKHRYARTSAQKARLVADLIRGKKVSVALEILTFTNKKAATLVKKVLESAIANAEH
NDGADVDDLKVAKIFVDEGPSMKRVMPRAKGRADRILKRTSHITVVVSDR
NT seq 333 nt NT seq  +upstreamnt  +downstreamnt
atggaaactattgctaaacatcgttacgctcgtacttctgcccaaaaagctcgcttagtt
gctgatttaattcgcggtaaaaaagtttctgtagcattagaaatcttaactttcactaac
aaaaaagcagcgacgcttgttaagaaagtattagagtcagctattgcaaacgcagagcat
aatgacggtgcagatgtcgatgatcttaaagttgctaaaatcttcgttgatgaaggtcca
agcatgaaacgtgtaatgccacgtgcaaaaggtcgtgcagatcgtattttaaaacgtaca
agccacatcactgtggttgtgtcagatcgttaa

DBGET integrated database retrieval system