KEGG   Mannheimia haemolytica M42548: MHH_c10020Help
Entry
MHH_c10020        CDS       T02635                                 

Gene name
nadR
Definition
(GenBank) bifunctional NAD biosynthesis protein NadR
  KO
K06211  HTH-type transcriptional regulator, transcriptional repressor of NAD biosynthesis genes [EC:2.7.7.1 2.7.1.22]
Organism
mhx  Mannheimia haemolytica M42548
Pathway
mhx00760  Nicotinate and nicotinamide metabolism
mhx01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mhx00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    MHH_c10020 (nadR)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mhx03000]
    MHH_c10020 (nadR)
Enzymes [BR:mhx01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.22  ribosylnicotinamide kinase
     MHH_c10020 (nadR)
   2.7.7  Nucleotidyltransferases
    2.7.7.1  nicotinamide-nucleotide adenylyltransferase
     MHH_c10020 (nadR)
Transcription factors [BR:mhx03000]
 Prokaryotic Type
  Helix-turn-helix
   Other families
    MHH_c10020 (nadR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AAA_28 HTH_19 HTH_3 CTP_transf_like HTH_31 HTH_26 FAD_syn HTH_AraC
Motif
Other DBs
NCBI-ProteinID: AGK01462
Position
complement(947758..949032)
Genome map
AA seq 424 aa AA seqDB search
MTDFAYLQQKRKQLKLKVNDICEQAGVTRAYFNQLVSGKIKNPSANKLKALHSVLDIVED
SNQRSGVIFGKFYPIHTGHINMIYEAFSKVDVLHVIVCTDSERDLRLFQESKMKRMPTNE
DRLRWVQQIFKYQQKQIFIHHLVEDGIPSYPNGWEDWSGRVKALFEEKSINPTIVFSSEI
QDKESYEKYLNLEVQLVDPTRESFNISATQIRNNPFQYWRFIPKEVRPFFVKTIAILGGE
SSGKSVLVSKLANVFNTTSAWEYGREFVFEQLGGNEQAMQYSDYPQMVLGHQRYVDYAMK
HAHKVAIIDTDYITTQAFCIQYEGKAHPFLDSMIREYPFDVTILLSNNTKWVADGLRSLG
SKKQRQQFQHLLKKLLEKHHIPYIKIESPSYLDRYNQAKEVVEAILNEEPIPLQFKQYNI
HEFE
NT seq 1275 nt NT seq  +upstreamnt  +downstreamnt
atgacagattttgcttatcttcaacaaaagcgcaaacagcttaaactcaaagtgaatgat
atttgtgaacaagctggggtaacccgagcttattttaatcagttagtaagcggaaaaatc
aaaaatccaagcgccaataagcttaaagccttgcattccgttttagatatcgtagaagat
agcaaccagcgttccggggttatttttggcaaattctatcctattcacacaggtcatatt
aatatgatctatgaagcatttagtaaagtagatgttttacatgttattgtttgtaccgat
tctgaacgggatttacgtcttttccaggaaagtaaaatgaaacgaatgccgacaaatgaa
gatcggctacgctgggtacagcaaatttttaaataccaacaaaaacagatctttattcac
catttagttgaagacggtattccgagctatccaaatggctgggaagattggtctggtcgt
gttaaagcgctatttgaagaaaaaagcattaatcctactattgtttttagtagtgaaatt
caagataaagaatcttatgaaaaatatttgaatctagaagttcaacttgtcgatcctact
cgtgaatcctttaatatttcagcaacacaaattcgtaataatccttttcaatactggcgc
tttattccgaaagaagttcgtcctttctttgttaaaactattgcgattttaggtggtgaa
agcagtggtaaatcagtgttggtgagcaaattagcgaatgtatttaacactacctctgct
tgggaatatgggcgtgagtttgtgtttgagcaacttggtggcaatgaacaagcaatgcaa
tattccgactatccgcaaatggtgcttggacatcaacgctacgttgattatgccatgaaa
catgctcataaagtggctattattgataccgattacatcacaactcaagcgttctgtatt
cagtatgaagggaaggctcacccgtttctggattcaatgatccgcgaatatccttttgat
gtgacgattttactttctaacaatacaaaatgggtagccgatggtttacgcagtttagga
tcgaaaaaacagcgtcaacagtttcaacacctactgaaaaaactactagaaaaacaccat
attccttatattaaaattgaatctccaagttatttggatcgctacaatcaagccaaagag
gtggtagaagctattttaaatgaagaaccaatcccattacagtttaagcaatataatatt
cacgaatttgaataa

DBGET integrated database retrieval system