KEGG   Mannheimia haemolytica M42548: MHH_c13670Help
Entry
MHH_c13670        CDS       T02635                                 

Gene name
rluD
Definition
(GenBank) 23S rRNA pseudouridine synthase RluD
  KO
K06180  23S rRNA pseudouridine1911/1915/1917 synthase [EC:5.4.99.23]
Organism
mhx  Mannheimia haemolytica M42548
Brite
KEGG Orthology (KO) [BR:mhx00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:mhx03009]
    MHH_c13670 (rluD)
Enzymes [BR:mhx01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.23  23S rRNA pseudouridine1911/1915/1917 synthase
     MHH_c13670 (rluD)
Ribosome biogenesis [BR:mhx03009]
 Prokaryotic type
  rRNA modification factors
   23S rRNA modification factors
    MHH_c13670 (rluD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PseudoU_synth_2 S4 S4_2
Motif
Other DBs
NCBI-ProteinID: AGK01818
Position
1304970..1305947
Genome map
AA seq 325 aa AA seqDB search
MTQQKILTAEITADLLGARLDQALAQLFPDYSRSRIKVWIESDLVKVNGNIVNKAREKVF
GGETVEITAEIEEEIRFEPQDIPLNIVYEDDDIIVINKPKDLVVHPGAGNPDGTVLNALL
HYYPPIAEVPRAGIVHRLDKDTTGLMVVAKNIPAQTHLVTALQKRRITREYEAIASGIMT
QGGKVDEPMARHPTKRTAMAVHPMGKPAVTHYRIMERFRNYTRLRLRLETGRTHQIRVHM
AHIAHPLLGDQLYGGRPRPPKGASDSFLSVLRGFQRQALHATMLRLEHPITGEMMEWHAP
LPDDFIELIQALKADYELYKDQLDY
NT seq 978 nt NT seq  +upstreamnt  +downstreamnt
atgactcaacaaaagattttaacagcagaaattactgcagatttactaggtgctcgccta
gatcaggctctggcacaactttttccggactattctcgttcacgcattaaagtgtggatt
gaaagtgatctagtgaaagttaatggcaatatcgtgaataaagcaagggaaaaagtattt
ggtggtgaaactgttgaaattaccgctgaaatagaagaggaaattcgttttgagcctcaa
gatattcctctaaatattgtgtatgaagatgacgatattatcgtcattaataaaccgaag
gatttagtggttcacccaggggctggtaatccggacggtacagtgctgaatgctttgcta
cattattatccaccgattgcagaagtgcctcgagcagggattgttcaccgattggataaa
gacacgacaggcttaatggtagtggctaaaaacattccggcacagactcacttagtaacc
gcattacaaaaacgtcgtattacccgtgaatatgaagcgattgccagcggcattatgaca
cagggcggaaaagttgatgagccaatggctcgccacccaactaaacgtacggcaatggct
gttcacccaatgggaaaaccggcggttacgcattatcgtattatggagcgttttcgtaat
tacacacgtttacgtttaagattagaaacagggcgtactcaccaaattcgggtacatatg
gcgcatattgctcacccattattaggtgatcagctctatggcggtagacctcgcccacct
aaaggtgcgagtgactcgtttttatcggtgttacgaggcttccaacgccaagccttacac
gccacaatgttgagattagagcatccgattactggtgaaatgatggagtggcacgccccg
ttacctgatgattttattgaattgattcaggcactaaaagcggattatgagctttataaa
gatcaattagattattaa

DBGET integrated database retrieval system