KEGG   Mannheimia haemolytica M42548: MHH_c14360Help
Entry
MHH_c14360        CDS       T02635                                 

Gene name
recB
Definition
(GenBank) exodeoxyribonuclease V beta chain RecB
  KO
K03582  exodeoxyribonuclease V beta subunit [EC:3.1.11.5]
Organism
mhx  Mannheimia haemolytica M42548
Pathway
mhx03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:mhx00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    MHH_c14360 (recB)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:mhx03400]
    MHH_c14360 (recB)
Enzymes [BR:mhx01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     MHH_c14360 (recB)
DNA repair and recombination proteins [BR:mhx03400]
 Prokaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     MHH_c14360 (recB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: UvrD-helicase UvrD_C AAA_19 UvrD_C_2 PDDEXK_1 AAA_12 ResIII AAA_30 AAA_25 AAA_11 DEAD Clathrin
Motif
Other DBs
NCBI-ProteinID: AGK01887
Position
1373091..1376615
Genome map
AA seq 1174 aa AA seqDB search
MKNLNPIQLPLNKSVLIEASAGTGKTFTIANLYLRLLLGIGCNPLTVEQILVVTFTKAAT
EELKNRIRKNIQQCADFLKDQADGLEVESTKSYRNNLDFLAQIYPLIPNIHEALLRLSIA
EREIDTASVFTIHGFCQKMLVQFAFESGVRFDLDLQPNQSDLLKKLSEEVWREQFYPQDL
AITYAVAEQLGTPEYALNAVRRYLSTELPEPNASLNQDIAEHLAQYQQFINEVKSYWKTH
SDELVETIRHDLKHKITLHGGWYRATTFEAGVEVMNQWANSQHNHFPAGLYLFTTEKIAA
GTKKSCEPIDSPHLAKNQAFLTAYKERFENSLSAMLQYQFLIALKAKLAEYKQSHPQRSF
DDLLTMLNQALKNLHTGEALSQKIRAMYPFAMIDEFQDTDLTQYEIFSQIFMAENAENGF
IMIGDPKQSIYKFRGADIFTYLRAAKQADEQFTLGKNWRSLPEVVQAVNNLFSFANDNSP
FLYEDIGFHPVEADSQKGQLVSEQGHFVGYITENSKLDDLAEMCAYQIHQQLEAMAQGKF
GVEKNGEFQSFAAKDIAILVRKGSQAKRIKKALAKRNIKSVYLAESASVFGSEIATELCW
LLQAALNPYHYKALLSALGSTLWGLTAAEIHRYKENEQLWDLKVNQFVEYSNIWKEQGVL
PMLHKIYLEQGIIERLKGLENADRLITDLLHLTEILQETSQALESEAELLRWYEKQVNSP
DFNDEQQLRLESEEELIKIVTIHGSKGLQYPIVWLPFVSQKSEGDTQTALSLYRNSQGAL
DWCLGSEEASFSLQYEAYAEDLRLLYVALTRAESQLNLVLPKEISGWSPLHYLLADGEIP
TGKVPVSDYFSQKRIAANLVEVAGELPFSLWEGEQSSDDYQAKTFSGNIRVVGQITSFTS
LYAQHERFSEGKSERVMDLAQDRDVHIETIEAGYSSETAAFSPFQFPHGIKVGTVLHHFF
EHCQFNEQIDREAVAKVCEQLGLSEEWIEPTALWFERILTTPLAEANFCLKAIDETKRLN
EWQFYLRLKNDKALHQLNALLKQHSPLAKTLPELQLPQLEGFVRGFVDCIVQVEEKFYLI
DYKSNFLGYLPQNYAKEHIQREMGRQRYDLQYLLYTLALHRYLTARLGEKYDYERDFGGV
AYLFLRAMNGENDNGVYFDKPTKQLIEEMDRLFG
NT seq 3525 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaacctaaatcctatccaactacctttgaataaatccgttttaatcgaagcgtcg
gcaggtacagggaaaacctttaccattgccaacctgtatttgcgtttattgctcggcatt
ggttgcaacccgttaacggtggaacaaattttggtggtgacatttaccaaagcagcaacc
gaagagttgaaaaaccgtatccgtaaaaatattcagcaatgtgccgactttttaaaagat
caagctgatggtttggaagtggaaagtacaaaatcctatcgaaacaaccttgattttttg
gcacagatttatccgctcattccgaatattcacgaagcattgttacgtttaagtattgcc
gaacgggaaattgataccgccagcgtgtttaccattcacggcttttgtcaaaaaatgctg
gttcagtttgcgtttgagtcgggcgtgcggtttgacttggatttacagccaaaccaaagt
gatctacttaaaaaattaagtgaagaagtctggcgagagcaattctatccgcaagattta
gccatcacttatgcggttgccgaacaacttggtacgccggaatatgccctcaatgcggta
aggcgttatttatctactgaattacctgaaccaaatgcctctttaaatcaagatattgcc
gagcatttggctcaatatcagcagtttattaatgaggtgaaatcctattggaaaacgcat
tcagatgaactggttgaaactatccgccacgatttaaagcataaaattacgctgcacgga
ggttggtatcgagcgaccacttttgaagccggtgtggaagtgatgaaccagtgggctaat
tcgcaacataaccatttcccggcagggctttatttattcactacagagaaaattgcggct
ggcacgaaaaagagctgtgagccgatagattcccctcatcttgcaaaaaatcaggctttt
ttgaccgcttacaaggaacgttttgaaaacagcttgtcagcaatgttgcagtatcaattt
ttaattgctctcaaagcaaaattggcagagtacaaacaatcgcacccacaacgcagtttt
gatgatttactcacaatgctaaaccaagcgttgaaaaatctacacacgggcgaagccttg
tctcagaaaattcgggcgatgtatccttttgcgatgatcgatgagttccaagataccgat
ttaacccaatatgaaattttcagccaaatttttatggcagagaatgcagagaacggcttt
attatgattggcgacccgaaacagtcgatctataaattccgtggggcggatattttcacg
tatttgcgagcagcaaagcaggctgatgaacaattcacattgggcaaaaactggcgttcg
ttgcctgaagtggtgcaagcggtcaataatttgttttcttttgcaaatgataactctccg
tttctttatgaggatattggctttcacccagtggaggctgatagccaaaaaggtcagtta
gttagtgagcaagggcattttgtaggctacatcacggaaaacagtaaattagatgatttg
gctgaaatgtgtgcttatcaaattcatcaacagcttgaggcgatggctcaaggcaaattc
ggagttgaaaaaaacggcgaatttcaatcctttgctgcaaaagatattgcgattttagtc
cgaaaaggttcacaagctaagcgaatcaaaaaggcgttggcaaaacgtaatatcaaatcc
gtctatttagctgaatcagcttctgtatttggttcggaaattgcaacagaattgtgttgg
ttattgcaagccgcactgaatccgtatcattacaaggcattattatcggcgttaggctca
accttgtggggcttaacggcggcagagatccaccgctataaggaaaatgagcaactttgg
gatctgaaagtcaatcagtttgtggaatacagcaacatttggaaagagcagggcgttctg
ccgatgttgcataaaatctacttggagcagggcattatcgaacgtttgaaaggtttggaa
aatgcggatcgcttgattacggatttattgcatttaaccgaaattttgcaggaaacctcg
caagcgttagagtctgaagctgaactgttgcggtggtatgaaaagcaagttaattcgccc
gattttaatgacgagcaacaacttcggttggaaagtgaagaggagctaatcaaaattgtg
acgattcacggctcgaaaggcttgcaatatccaattgtttggttaccttttgtttcacaa
aaaagtgagggagacacgcagacagcattaagtttatatcgcaattctcaaggtgcgctg
gattggtgtttaggctcagaagaggcaagtttttcgctacagtatgaggcttatgcggaa
gatttacgtttgctgtatgtggcattaacccgcgcggaatctcagcttaacttagtgttg
ccgaaagagatttccggctggtctccactccattacttgttagcagacggggaaatacct
acaggaaaagtgcctgtttcagattattttagccaaaaacggattgctgctaatttggtt
gaagtagccggggaattacctttctcactgtgggaaggagaacaatcttcagacgattac
caagcaaaaacctttagtggcaatatccgtgtggttggtcaaattaccagctttacttca
ctttatgcccaacacgagcgttttagtgaagggaaatcagaaagggtaatggatttagcc
caagatcgagatgtacatatagaaaccattgaggcaggttattcaagtgaaactgccgct
ttctcgccattccaattcccacacggtattaaagtgggcacggtgttacatcactttttt
gagcattgccaatttaacgaacaaattgatagagaggctgttgctaaagtatgcgagcaa
ttagggctaagcgaggaatggattgaaccaacagcattatggtttgagcgtattctaact
acccctttggcagaggcaaatttctgcttaaaagcgattgatgaaaccaaacgattaaac
gagtggcaattctatttacgcttaaaaaatgataaagccttacatcaattaaatgcgtta
ttaaagcaacatagccctttagcaaaaactttacctgaattgcaattaccgcaattagaa
ggttttgtgcgaggctttgtagattgtatcgtgcaagtggaggagaaattctacttaatt
gattacaaatcgaatttcttaggctatctgccacaaaattatgcgaaagaacacattcaa
cgggaaatgggcagacaacgctatgatttgcaatatctgctttacactctcgccttacac
cgttatctaactgcccgtttaggtgaaaaatacgattatgaacgagacttcggcggagtg
gcttacttgttcttaagggcaatgaacggcgaaaatgataacggcgtttattttgacaag
ccgactaagcagttgattgaagaaatggatcggttgtttgggtaa

DBGET integrated database retrieval system