KEGG   Mannheimia haemolytica M42548: MHH_c24060Help
Entry
MHH_c24060        CDS       T02635                                 

Gene name
rnc
Definition
(GenBank) ribonuclease 3
  KO
K03685  ribonuclease III [EC:3.1.26.3]
Organism
mhx  Mannheimia haemolytica M42548
Brite
KEGG Orthology (KO) [BR:mhx00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA Biogenesis [BR:mhx03019]
    MHH_c24060 (rnc)
   03009 Ribosome biogenesis [BR:mhx03009]
    MHH_c24060 (rnc)
   03036 Chromosome and associated proteins [BR:mhx03036]
    MHH_c24060 (rnc)
Enzymes [BR:mhx01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.26  Endoribonucleases producing 5'-phosphomonoesters
    3.1.26.3  ribonuclease III
     MHH_c24060 (rnc)
Messenger RNA biogenesis [BR:mhx03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Ribonucreases
     MHH_c24060 (rnc)
Ribosome biogenesis [BR:mhx03009]
 Eukaryotic Type
  90S particles
   RNase
    MHH_c24060 (rnc)
 Prokaryotic Type
  rRNA processing factors
   MHH_c24060 (rnc)
Chromosome and associated proteins [BR:mhx03036]
 Eukaryotic Type
  RNA silencing
   microRNA pathway
    Microprocessor complex
     MHH_c24060 (rnc)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribonucleas_3_3 Ribonuclease_3 dsrm DND1_DSRM
Motif
Other DBs
NCBI-ProteinID: AGK02844
Position
complement(2279791..2280465)
Genome map
AA seq 224 aa AA seqDB search
MQLERLQKKLGYQFHNLDYLIQALTHRSAATKNNERLEFLGDSILNFTIGKVLYDKFPKA
NEGELSRMRATLVREQTLAIIARKFDLGDYLKLGPGELKSGGFRRESILSDCVEAIIAAI
YLDQDMAKAMEKVEDWYSDLLKDISPGDSQKDPKTRLQEFLQGRKLPLPEYDVLDIKGEA
HNQTFRVTCKVINVEEVFIGIGTSRRKAEQNAAEKALAVVKTKK
NT seq 675 nt NT seq  +upstreamnt  +downstreamnt
atgcaactagaacgattacagaaaaaattaggttatcaatttcataaccttgattacctc
attcaggccttaacacaccgcagtgcggcaaccaaaaacaatgagcgtcttgaatttcta
ggcgattcaattttaaattttactattggtaaagtattatacgacaaatttccaaaagcg
aatgaaggtgagcttagccgtatgagagcaactcttgtgcgtgagcaaactctagcgatt
attgctcgcaaatttgatttaggcgactacctaaaattaggtccaggagagctaaaaagt
ggtggttttcgccgagaatcgattttatcggactgtgttgaagcgattattgcggccatt
tatctcgatcaagatatggcaaaagcaatggaaaaggtggaagattggtattcagatttg
cttaaagatatcagtccaggcgattcacaaaaagatccaaaaacccgcctgcaagagttt
ttacaaggtagaaaattgccattgcctgaatatgatgtattagatattaaaggcgaagct
cataaccaaactttccgtgtaacctgtaaagtgattaacgtcgaggaagtgtttatcggc
attggcaccagccgccgaaaagccgaacaaaatgccgcagaaaaagcgttagcggtggtt
aaaacgaaaaagtaa

DBGET integrated database retrieval system