KEGG   Mannheimia haemolytica M42548: MHH_c24160Help
Entry
MHH_c24160        CDS       T02635                                 

Definition
(GenBank) hypothetical protein DUF692
  KO
K09930  uncharacterized protein
Organism
mhx  Mannheimia haemolytica M42548
Brite
KEGG Orthology (KO) [BR:mhx00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99997 Function unknown
    MHH_c24160
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF692 AP_endonuc_2
Motif
Other DBs
NCBI-ProteinID: AGK02854
Position
2290449..2291372
Genome map
AA seq 307 aa AA seqDB search
MLKFTGAGLGYRRDLADGFLSLTDNNIINFMEVAPENWLKMGGQARYNFDKVAEKIPVII
HGLSLSLGGQAPLDMTLLKGIKNMQQQYNSFFFSDHLSYCECEGHLYDLLPMPFTDEAVH
HVANRIKQVQDYLGMQISLENTSYYLHSPTSTMNEVEFLNAIAQEADCGIHLDVNNIYVN
GVNHGLLDPFVFIDQVDKSRVNYIHIAGHDEDHGAAEDVKMTEGESFNMVKGELRHLPTL
LVDTHGEAVQKTVWDLLEYTYEHLPHIPPTLLERDFNFPPFQELISEVQHIMSLQKKYAK
TRLKNAA
NT seq 924 nt NT seq  +upstreamnt  +downstreamnt
atgttaaaatttactggtgccggtctaggctatcgccgtgacctagcggacggattttta
tctctcacagataacaatataattaattttatggaagtagccccagaaaactggctgaaa
atgggcggtcaggctcggtataacttcgataaagtcgctgaaaaaatccctgttattatt
cacggtttatccctctctctcggcgggcaagcgcctttagatatgacgctactaaaaggg
atcaagaatatgcagcagcagtataactcctttttcttctctgatcatttaagctattgc
gaatgtgaagggcatttatatgacctgctgccaatgccgtttaccgatgaagccgtacat
cacgtggcaaatcgcattaaacaagtgcaagattatttaggtatgcaaatttcccttgaa
aatacgtcctactatctgcattcaccaaccagtacgatgaatgaggtagagtttctcaat
gcaattgcccaagaagcggattgtggcattcaccttgatgtgaataatatttatgttaat
ggtgtcaatcacggcttgcttgatccatttgtatttattgatcaagtggataaatctcgt
gtcaattatattcatattgcaggccacgatgaagatcacggtgcggcggaagacgttaaa
atgaccgagggtgaatcatttaatatggtaaaaggcgaactacgtcatctgccaacttta
ctggtcgatacacacggagaagctgtacaaaaaactgtgtgggatttactagagtacacc
tatgaacacctaccgcatattccaccaacactgttagaacgggatttcaacttcccaccg
tttcaagaactgattagtgaagtacagcacattatgagcttacagaaaaaatatgcaaaa
acgaggctaaaaaatgccgcttaa

DBGET integrated database retrieval system