KEGG   Mannheimia haemolytica M42548: MHH_c24170Help
Entry
MHH_c24170        CDS       T02635                                 

Definition
(GenBank) hypothetical protein DUF2063
  KO
K09929  uncharacterized protein
Organism
mhx  Mannheimia haemolytica M42548
Brite
KEGG Orthology (KO) [BR:mhx00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99997 Function unknown
    MHH_c24170
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF2063 Mto2_bdg
Motif
Other DBs
NCBI-ProteinID: AGK02855
Position
2291362..2292102
Genome map
AA seq 246 aa AA seqDB search
MPLKLVEEHKPLLKEIQAEFANAIRHNDVKLMSGNISPQRLGVYSRLVRNNTLGFIDRCY
VQLPQHLSPEEWVAVKEKFIREGKAHSPFFQDIAGEFLNFCRENGCMPPHLLELMDFENA
QLLAEVSMATVPSEFEWDNDTIMQFSGAAELRQYAVNFIRSEFKQFDFEPTNVLIWRDTE
FGIYYNRLEELDFFLLSSLQEGANSLNGLLAELSEFTEQNLELKALLRQLWEKWVEAEVI
YPVYPE
NT seq 741 nt NT seq  +upstreamnt  +downstreamnt
atgccgcttaaactcgttgaagaacacaaaccgttactcaaagagattcaagccgagttt
gcgaatgcaattcgccataacgatgtaaagctgatgagtggtaatatctctccacagcgg
cttggcgtctattctcgcttggttcgcaataatactctcggttttatcgaccgttgttat
gtacagctccctcaacatctaagtcctgaagaatgggttgccgttaaagaaaaatttata
cgagaaggtaaggctcattcgccctttttccaagatattgctggcgaatttctcaatttt
tgccgagaaaatggctgtatgccaccacacttgcttgagttgatggactttgaaaatgct
caattactggctgaggtatcaatggcaaccgtaccatcagaatttgaatgggataacgat
actataatgcagttttctggtgcagctgagctgcgtcaatatgcggtaaactttatccgt
agcgagttcaaacagtttgactttgagccgaccaacgtactgatttggcgagatacggaa
tttggcatctattacaaccgcttggaagagctggatttcttcctgcttagctcgttgcaa
gagggggcaaattccctgaatggcttactagcagaactcagcgagtttaccgagcaaaat
ctggagctaaaagccttgttacgccaactttgggaaaaatgggttgaagcagaggtgatt
tatcctgtctatcctgaatga

DBGET integrated database retrieval system