KEGG   Mannheimia haemolytica M42548: MHH_c24380Help
Entry
MHH_c24380        CDS       T02635                                 

Definition
(GenBank) putative HTH-type transcriptional regulator
Organism
mhx  Mannheimia haemolytica M42548
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_S24 HTH_Tnp_Mu_1
Motif
Other DBs
NCBI-ProteinID: AGK02876
UniProt: M9X2I9
Position
complement(2314794..2315522)
Genome map
AA seq 242 aa AA seqDB search
MKSFDKVWFSAKELEELDLPDLPKQATNITRKALKELWIKRDAVGVKGGGNEYHITSLPR
KAQEALGFKSGINAIKDSIVREITPEEQNKGSELSGTVLNNIISMIDSFASIKVSAGFGS
FNEGVTKPDGQEPYADSLLHTLGVNAKKCAVFWASGDSMYPTIDNGDQLLVDLSRNEIRG
DNNIYIVQNGDSVWVKRVKLLWDGVELISDNREEYELIKITADQAQNLQIIGQVVHIGHS
LV
NT seq 729 nt NT seq  +upstreamnt  +downstreamnt
atgaaatcatttgataaagtttggttttcagccaaagaactagaagaattggatttgcct
gaccttccaaagcaagcaacaaacattacaagaaaggcattaaaagaactctggataaaa
cgtgatgcagttggagtaaaaggtggggggaatgaatatcacataacttcattgcctcgt
aaagcccaagaagcactcggatttaaaagtggaataaatgcaatcaaggatagcatagta
agagagattacacctgaagagcaaaacaaaggatctgaattatcaggcaccgttttgaat
aacataatctcaatgattgatagttttgcatctattaaagtatctgcaggctttgggagc
tttaatgaaggtgtaacaaaacctgatggacaagagccttatgctgatagcttgttgcat
acgcttggtgttaatgccaagaagtgtgctgttttttgggcaagtggagactcgatgtat
ccgactattgataatggcgaccagctactagttgatttaagtcgtaatgagatacgaggc
gacaataatatttacattgtacaaaacggcgacagtgtttgggttaagcgtgtaaaactg
ctatgggacggtgtagagcttatttcagacaaccgagaagagtacgagttaataaagatt
acagcagaccaagcccaaaacctacaaatcatcgggcaagtggtacacatcgggcattct
ttagtttaa

DBGET integrated database retrieval system