KEGG   Mannheimia haemolytica M42548: MHH_c24550Help
Entry
MHH_c24550        CDS       T02635                                 

Definition
(GenBank) putative secretion activating protein
Organism
mhx  Mannheimia haemolytica M42548
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_108 PG_binding_3
Motif
Other DBs
NCBI-ProteinID: AGK02893
Position
2324237..2324770
Genome map
AA seq 177 aa AA seqDB search
MTEPIKNKATIADFNLAFDRLIGHEGGYVNDPKDPGGETNWGITIHTARANGYTGSMRAM
SRADAKTIYLKAFWQRYNCEQFPPELAFQFLDACVNHGSGNASRMLQRAVGVADDGIIGK
VTLAAIERYSVADVGLLFQAERLEFYTKLKHFDRFGRGWINRMAGNLRYFAKDTVEE
NT seq 534 nt NT seq  +upstreamnt  +downstreamnt
atgactgaacctatcaaaaacaaggcaactattgctgactttaatcttgcatttgaccgt
cttatcggacacgagggcggttatgtgaacgacccgaaagaccccggtggcgaaacgaat
tggggtatcactatccatactgcccgtgcgaatggctataccggctctatgcgtgcaatg
agccgtgcggatgcgaaaactatttacctcaaagccttttggcaacgttataactgtgag
cagttcccgcctgagttggcttttcagtttttagatgcgtgtgtaaaccacggttcgggc
aatgctagccgaatgttacagcgagcggtaggtgtggctgatgacggcattatcggtaaa
gtgactttggctgcgattgagcgttattcggttgcggatgtgggcttgttatttcaggca
gaacgccttgagttttacaccaaactcaaacactttgaccgttttggtagaggttggatt
aaccgaatggcgggtaatttgcgttattttgccaaagacacggtggaggaataa

DBGET integrated database retrieval system