KEGG   Mannheimia haemolytica M42548: MHH_c24620Help
Entry
MHH_c24620        CDS       T02635                                 

Definition
(GenBank) hypothetical protein
Organism
mhx  Mannheimia haemolytica M42548
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: AGK02900
UniProt: M9X463
Position
2326556..2326702
Genome map
AA seq 48 aa AA seqDB search
MAKKKQTVVHKHYSFRWIVQLACIFGAIKLMLNGTDGWGWLLLIAACM
NT seq 147 nt NT seq  +upstreamnt  +downstreamnt
atggctaagaaaaaacaaactgtagtgcataagcattactctttccgttggattgtccaa
cttgcttgtattttcggagcaataaaactaatgctcaacggtacagacggttggggctgg
ttgttgcttatcgcagcttgtatgtaa

DBGET integrated database retrieval system