KEGG   Mannheimia haemolytica M42548: MHH_c24780Help
Entry
MHH_c24780        CDS       T02635                                 

Definition
(GenBank) Mu-like prophage DNA circularization protein
Organism
mhx  Mannheimia haemolytica M42548
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_circ_N
Motif
Other DBs
NCBI-ProteinID: AGK02916
Position
2340468..2341760
Genome map
AA seq 430 aa AA seqDB search
MSGWTMPIQQASFKGVRFDVLAVDDSFERAVVEHAYPFVNGADLEDMGLNTQTIRLQAVF
FGSSYYTDYIRLLSVLQQKGADVLVHPIRGRLPNMLLVSANLHTDAENINYVALDLTFKE
ATEMQPIFAFEDSLISKIDKLLLDLENLFDDGLRFWDSVGVFDLKSRLLGLWGALFASFE
AVRNLFDLDKKKYSIASSTSQRTYLRDGSGALNQLKEMVDSGIQGRADLTTLSFKSQLLN
ITDAIDNTQAIVSKVARDEGFNRSKTVKLLGSDVVELGIMLDLIATTKLTKVLTELVEER
EEELLIGDLELINQIVREHWLNIINKLREQQKNTQKGVPSDKTKVIYETAEKLINNIRNV
AHQFTALVLAVINKKPPLTVRMVMDSGTIHKVAHAFYGDYERADELLRLNPHIRQPNFIE
RGTLLNCYWE
NT seq 1293 nt NT seq  +upstreamnt  +downstreamnt
atgagcggttggacaatgcctattcaacaggcgagttttaaaggtgtgcgttttgacgtg
cttgcagtggatgatagctttgagcgagcggtagttgaacacgcctacccttttgtaaat
ggggctgatttagaggatatggggctaaacacccaaactattcggctgcaagcggtcttt
tttggctcaagctattacacggactatatccgcttactttcagttttgcagcaaaaaggg
gctgatgtattagtccaccctattcgtgggcgtttaccgaatatgttactcgtttcggcg
aatctacataccgatgccgaaaatatcaattatgttgccttagatttgacctttaaagag
gcaaccgaaatgcagccgatttttgcctttgaagattcgctgatttcgaaaatcgacaag
ctgctacttgatctcgaaaacctgtttgatgatggcttgcgtttttgggatagcgttggg
gtgtttgatctgaaatctcgtttgcttgggctttggggggcgttgtttgcctcgtttgag
gcggtgcgtaacctgtttgacttggacaagaaaaaatacagcattgcctcatcaacctca
caacgcacctatttaagagacggttcgggggcattgaatcagttaaaagaaatggtggat
agcggtattcaggggcgtgctgatttaacgacactctcgtttaaatctcagttactcaat
attactgatgcgatagataacactcaggcgattgtgagcaaagtggctagagatgagggt
tttaaccgctcaaaaacggttaagttacttggctctgatgtggttgagcttggcattatg
cttgaccttattgccacgactaagctcaccaaagtcttgactgagctggtagaagagcgt
gaggaagagctgctaattggtgatttagagttaattaaccaaattgtgcgtgagcattgg
ctgaatattatcaacaaactgcgtgagcaacagaagaacactcaaaaaggcgtgccgagt
gataagacaaaagttatctacgagaccgcagaaaagctgatcaacaatatccgtaatgtt
gcccatcagtttactgcacttgtgcttgcggtaattaataaaaaaccgcctttgaccgtg
cgaatggtaatggatagcggcacaatccataaagtagctcacgccttttatggggattat
gagcgagcggatgagctattacgtcttaatccgcatattcgccagccaaactttattgag
cgaggcacgctgttaaattgttattgggagtaa

DBGET integrated database retrieval system