KEGG   Mannheimia haemolytica M42548: MHH_c24830Help
Entry
MHH_c24830        CDS       T02635                                 

Definition
(GenBank) hypothetical protein DUF2313
Organism
mhx  Mannheimia haemolytica M42548
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF2313
Motif
Other DBs
NCBI-ProteinID: AGK02921
UniProt: M9X2Q8
Position
2345097..2345687
Genome map
AA seq 196 aa AA seqDB search
MVTINSKHGKALGGLLPPVSYDPNGRWLALSLEVEGRELDRIDARAKTLIDAVDVSTGIF
IDDWERVCGLTANSSLPLETRIERVIAKLNQLGGLSIGYITQVAKELGYCIKISEPQPFI
AGLSRAGDMLWHKDIMWTFFVDICNPTDDYKRFRASVSMAGDALMGRYKDPILESLLEEV
KPAFSRVWVRYLGDIE
NT seq 591 nt NT seq  +upstreamnt  +downstreamnt
atggtaacgattaactctaaacacggcaaggcattgggcggtttattaccgcctgtatcg
tatgacccaaacggcagatggctagcgttatcccttgaagttgaggggagagagctagac
cgcattgatgcgagagccaagactttaatcgatgccgttgatgtatcaacaggcattttt
attgatgattgggagcgggtttgtggcttaacggcgaatagctcactaccgcttgaaacc
cgaattgagcgtgtgattgcaaagctgaatcagttgggtggattgtcgataggctatatc
actcaagtggccaaagagcttggatattgcatcaaaattagtgagccacaaccctttatt
gctgggctaagccgagctggggatatgttatggcataaagacattatgtggacatttttt
gtggatatttgcaaccccacagatgattacaagcgttttagagcaagtgtgtcaatggct
ggcgatgcgttaatgggacgatacaaagacccaattttagaaagtctacttgaagaggta
aaacctgcatttagccgtgtgtgggtaagatatttaggagatattgaatga

DBGET integrated database retrieval system