KEGG   Mannheimia haemolytica M42548: MHH_c24940Help
Entry
MHH_c24940        CDS       T02635                                 

Definition
(GenBank) putative RluA-like tRNA pseudouridine synthase
  KO
K06177  tRNA pseudouridine32 synthase / 23S rRNA pseudouridine746 synthase [EC:5.4.99.28 5.4.99.29]
Organism
mhx  Mannheimia haemolytica M42548
Brite
KEGG Orthology (KO) [BR:mhx00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:mhx03009]
    MHH_c24940
   03016 Transfer RNA biogenesis [BR:mhx03016]
    MHH_c24940
Enzymes [BR:mhx01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.28  tRNA pseudouridine32 synthase
     MHH_c24940
    5.4.99.29  23S rRNA pseudouridine746 synthase
     MHH_c24940
Ribosome biogenesis [BR:mhx03009]
 Prokaryotic Type
  rRNA modification factors
   23S rRNA modification factors
    MHH_c24940
Transfer RNA biogenesis [BR:mhx03016]
 Prokaryotic Type
  tRNA modification factors
   Psudouridine synthases
    MHH_c24940
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PseudoU_synth_2 TruB_N
Motif
Other DBs
NCBI-ProteinID: AGK02931
Position
complement(2355813..2356466)
Genome map
AA seq 217 aa AA seqDB search
MTPTLPICYQHRDFIIINKPEGLSVHKDEAEIGLTELVARQLNVKQVWLVHRLDKITSGL
LILALNKEAAARFYHLFEQHKIYKTYWALSDKKPKKKQGRIVGDMQKSRNGAWKLCHSKE
NPAVTQFISHSVEDSLRHFILQPKTGKTHQLRVAMKSLGSPILGDKLYSGSQADRVYLHA
YQLDFEYENEKISVQALPTSGHFWQKICKSNHIKHGE
NT seq 654 nt NT seq  +upstreamnt  +downstreamnt
atgaccccaacattgcctatttgttatcaacatcgtgattttattattatcaataagccg
gaaggcttgagtgtgcataaagatgaggctgaaatcggcttaacggaattagtggctcgc
caactgaatgtaaagcaggtttggctggttcaccgtctggataaaatcacctcaggttta
ctgattttagcgttgaataaagaggcggcagcaaggttttaccatttatttgaacagcat
aaaatctacaaaacctattgggcattaagcgataaaaagccgaagaaaaagcagggtaga
attgttggcgatatgcaaaaaagcagaaatggagcgtggaaattatgccacagtaaggaa
aacccggcagtaacgcaatttatttctcattctgttgaagactcgctcaggcattttatt
ttgcaacccaaaacaggcaaaactcaccaattaagagtggcaatgaaaagtttgggcagc
ccgattttaggtgataaactctattcaggtagccaagccgaccgtgtttatttgcacgct
tatcagcttgattttgaatacgaaaatgagaaaatctcagtgcaagccttgccgacaagc
ggtcatttttggcaaaaaatttgcaaatccaatcacatcaaacacggagaatag

DBGET integrated database retrieval system