KEGG   Mannheimia haemolytica M42548: MHH_c24970Help
Entry
MHH_c24970        CDS       T02635                                 

Gene name
dusC
Definition
(GenBank) tRNA-dihydrouridine synthase DusC
  KO
K05541  tRNA-dihydrouridine synthase C [EC:1.-.-.-]
Organism
mhx  Mannheimia haemolytica M42548
Brite
KEGG Orthology (KO) [BR:mhx00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:mhx03016]
    MHH_c24970 (dusC)
Enzymes [BR:mhx01000]
 1. Oxidoreductases
  1.-  
   1.-.-  
    1.-.-.-  
     MHH_c24970 (dusC)
Transfer RNA biogenesis [BR:mhx03016]
 Prokaryotic Type
  tRNA modification factors
   Dihydorouridine synthases
    MHH_c24970 (dusC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dus His_biosynth
Motif
Other DBs
NCBI-ProteinID: AGK02934
Position
complement(2358257..2359210)
Genome map
AA seq 317 aa AA seqDB search
MNPIPNVILAPMQGVLDPFVRNLLTSVNDYDLCISEFVRVVDQRLPKKTFYRLAPELYQG
GLTDSGTPVRVQLLGQHPQWLAENAALAIELGSHGVDLNCGCPSKTVNGSNGGASLLKDP
ELIYRATKAMREAVPSDKIVSVKVRLGWDSVSQCFEIADAVEQGGANEITVHGRTKVDGY
RAERINWQAIGEIQQRLSIPVIANGEIWDFESAKNCQKITACKALMMGRGALNTPNLSKV
VKYNVPKMAWNEVLQLLFKYVQMENQFDTGFYHVARIKQWLRYLDKEYPQAVELFDILKT
EHGYDGLKAHIEKAVEE
NT seq 954 nt NT seq  +upstreamnt  +downstreamnt
atgaatccaattcctaacgttattcttgccccgatgcaaggggttttagacccttttgtc
cgcaaccttttaacttcagtgaatgactacgatctctgtatttccgaatttgtgcgagtg
gtcgatcaacgtttaccgaagaaaaccttttatcgcctagcccctgagctatatcaaggc
ggattaaccgattccggcacaccagtgcgggtacagcttttagggcaacacccacagtgg
ctggcagaaaatgcagctcttgccattgagcttggttcacacggggtagatctcaactgt
ggctgcccctctaaaacggtaaatggcagcaatggtggggcttcgttattaaaagatccg
gaactgatttatcgtgcaaccaaagcgatgcgtgaagctgtgccaagcgataaaatcgtt
tccgtaaaagtgcgattaggttgggattccgttagccaatgttttgaaattgccgatgcg
gtagaacagggcggagcgaatgaaattaccgttcacgggcgaaccaaagttgatggttat
cgagcagaaagaattaattggcaggcgattggcgaaattcaacaacggctgtctattcct
gttatcgccaacggcgaaatttgggattttgaatcggcgaaaaattgccaaaaaataacc
gcttgcaaggcattaatgatggggcgtggggcgttaaacacaccgaatttaagcaaagtg
gtgaaatataatgttccgaaaatggcgtggaatgaagtgctacagctattgtttaagtac
gttcagatggaaaatcagtttgataccggtttttaccacgttgctcgcatcaaacaatgg
ctacgttatttggataaagaatatcctcaagcggtagaattatttgatatcttgaaaacc
gaacacggctatgatggtctaaaagcacatattgaaaaggcagtggaggaataa

DBGET integrated database retrieval system