KEGG   Mannheimia haemolytica M42548: MHH_c25250Help
Entry
MHH_c25250        CDS       T02635                                 

Definition
(GenBank) hypothetical protein
Organism
mhx  Mannheimia haemolytica M42548
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: AGK02961
Position
complement(2380427..2380576)
Genome map
AA seq 49 aa AA seqDB search
MGATDRLIKLIYLIFRATSQNEKTTSGHFSTFFAKNRRKMTACQKKLII
NT seq 150 nt NT seq  +upstreamnt  +downstreamnt
gtgggggctactgatcgtttaatcaagttaatttatcttatttttcgagccacatcacaa
aacgagaaaacaacaagcggtcatttttccacgttttttgcaaaaaatcgaagaaagatg
accgcttgccagaaaaaattaattatttga

DBGET integrated database retrieval system