KEGG   Mannheimia haemolytica M42548: MHH_c25310Help
Entry
MHH_c25310        CDS       T02635                                 

Gene name
tqsA
Definition
(GenBank) quorum signal AI-2 exporter TqsA
Organism
mhx  Mannheimia haemolytica M42548
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AI-2E_transport DUF1198
Motif
Other DBs
NCBI-ProteinID: AGK02967
Position
2382873..2383925
Genome map
AA seq 350 aa AA seqDB search
MTHSTKTLVAIASIIIILAGIKLSNEIVVPFLLSLFIAIICSPMIKFMTKRKVPLWLAIT
ILLIVFILGFSFLAGIINNTLQEFTNAIPQYKIQLSSRIQVILELAHRWHIPLTLSQEEI
MSKFDPSSIMNLVSKLLMGLSGALSNIFVIFLVVIFMLLEMPVAKYKLALALSPDDDLSN
EKEYINQVLEGVIGYLGVKTFVSLLTGGLVWILLEILGVEYAILWAILTFLLNYVPNIGS
ILAGIPIVIQALVLNGFSIGLGTLIGIVVINMVVGNALEPKLMGKKLGLSTLVVFLSLLF
WGWLLGTVGMLLSVPLTMACKVALESNKATQKYAVLFSDLEEVPKEQKYR
NT seq 1053 nt NT seq  +upstreamnt  +downstreamnt
atgacacattccaccaaaactctcgtggcgatagcctccattatcattattctggcaggg
attaaattatccaatgaaattgttgtgccatttttactttcgctatttattgccattatt
tgttcaccaatgatcaaatttatgactaagcgtaaagtgccattatggttagccattacc
attttacttattgtttttatcttaggattcagtttcttagcaggcattattaataacacc
ttgcaagaatttactaatgctattccgcaatacaaaattcagctttcatctagaatccag
gtgattctagaactcgcccatagatggcatattccacttaccctctcacaagaagagatt
atgagcaaatttgacccaagctcaataatgaatttggtcagcaaactgctaatggggcta
tccggtgcattatcgaatatttttgtgattttcttagtcgtcatttttatgctattggaa
atgccggttgccaaatataaattagccctcgcacttagcccagatgatgatttaagcaac
gaaaaagagtatatcaaccaagtacttgaaggggtgattggttaccttggagttaaaacc
tttgtgagcctactcaccggagggttagtttggatcttactagaaattctaggcgtagaa
tatgcgattttatgggcaattctaaccttcctgcttaactacgtcccgaatatcggctct
attttggcgggaattccaattgtgattcaagccttggtactcaatggcttttctatagga
ttaggcactttaatcggcattgtcgtgattaatatggttgtgggtaatgcgcttgaacct
aaattaatgggcaagaaactcgggctttctacccttgtagtgttcctctcacttctattt
tgggggtggttacttggcaccgtaggaatgttactttctgttccacttacgatggcgtgt
aaagtggcattagaatccaataaagccacccaaaaatatgccgtattatttagcgattta
gaagaagtaccgaaagaacaaaaatatcgttaa

DBGET integrated database retrieval system