KEGG   Mannheimia haemolytica M42548: MHH_c25390Help
Entry
MHH_c25390        CDS       T02635                                 

Definition
(GenBank) cupin 4 family protein
Organism
mhx  Mannheimia haemolytica M42548
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cupin_4 Cupin_8 Cupin_2 ARD
Motif
Other DBs
NCBI-ProteinID: AGK02975
Position
complement(2390411..2391061)
Genome map
AA seq 216 aa AA seqDB search
MHRSKDMPEYAPNLDDVYMDIVLEAGDVLYLPRGWWHDPIPVGEETVHLAVGIFPAYTHN
YLTWVSQNMVEKEIARASLSHYESDKELIAQLAEQTAEYIKDKENYHKFIENFYDQKRVE
KPLNLETLGNYQYDSISENQKISFKAKNHYFGYENKIISNGYGISLDEEFGNVIKFLKQG
QEVSLNDILEKISEDKRDKVSQLIWQLSYIGVLKLS
NT seq 651 nt NT seq  +upstreamnt  +downstreamnt
atgcatcgtagtaaagatatgcctgaatatgctcctaatcttgatgatgtatatatggat
attgtattagaagctggagatgttctttatttacctcgtggctggtggcacgatcctatt
cctgttggagaagaaactgtgcatttagctgtaggcatttttcctgcttatactcataac
tatctgacttgggtatctcaaaatatggttgagaaagaaattgcccgagcttctttatcg
cattatgagtcagataaagagttgatagcacagttggcagaacaaacagcagaatatatt
aaagataaagagaattatcataaatttatagagaatttttatgatcagaagcgggttgaa
aagccacttaatttggaaactttaggaaattatcaatatgattctatttcggaaaatcaa
aaaatttcatttaaagccaaaaatcactactttggttatgaaaataagataatttcaaat
ggatatggtatttctcttgatgaagagtttggaaatgttattaaatttcttaaacagggt
caggaagtttcattaaatgatattttagaaaaaatatcagaagataaacgagataaagtt
tctcagcttatttggcagttatcttatattggtgtgctaaaattgagttaa

DBGET integrated database retrieval system