KEGG   Mannheimia haemolytica M42548: MHH_c25480Help
Entry
MHH_c25480        CDS       T02635                                 

Gene name
folD
Definition
(GenBank) bifunctional protein FolD
  KO
K01491  methylenetetrahydrofolate dehydrogenase (NADP+) / methenyltetrahydrofolate cyclohydrolase [EC:1.5.1.5 3.5.4.9]
Organism
mhx  Mannheimia haemolytica M42548
Pathway
mhx00670  One carbon pool by folate
mhx01100  Metabolic pathways
mhx01120  Microbial metabolism in diverse environments
mhx01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:mhx00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    MHH_c25480 (folD)
Enzymes [BR:mhx01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.5  methylenetetrahydrofolate dehydrogenase (NADP+)
     MHH_c25480 (folD)
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.9  methenyltetrahydrofolate cyclohydrolase
     MHH_c25480 (folD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: THF_DHG_CYH_C THF_DHG_CYH adh_short UDPG_MGDP_dh_N
Motif
Other DBs
NCBI-ProteinID: AGK02984
UniProt: M9X7S2
Position
complement(2399206..2400066)
Genome map
AA seq 286 aa AA seqDB search
MTAQIISGSEVSSQIKKKVSEKIAHYLEQGKRNPGLAVILVGNDPASQVYVGSKRKSCAE
IGIASKSYDLPEETTEAELLALIEKLNQDDSVDGILVQLPLPKQIDSTKVIEAILPHKDV
DGFHPYNVGRLSQRIPTLRPCTPYGVMKLLETTGVDLYGQHAVIVGASNIVGRPMALELL
LGGCTVTVTHRFTKDLEHHVRQADILVVAVGKPEFIPGEWVKDGAIVIDVGINRGADGKL
KGDVEYSVASQKAAFITPVPGGVGPMTVAMLMQNTLQTYENHLQAV
NT seq 861 nt NT seq  +upstreamnt  +downstreamnt
atgactgcacaaattatttcggggagtgaggtttcttcacaaattaaaaaaaaggtgagt
gagaaaatcgctcattatcttgaacagggtaaacgtaaccctggtcttgcggtcatttta
gtggggaatgacccagcctctcaagtgtatgtggggagtaaacgcaaaagctgtgccgaa
attgggattgcgtcgaaatcttatgatttacccgaagaaaccacagaggctgaattatta
gcactgattgaaaagttgaatcaagatgattcggtcgatgggattttagtccaattaccg
ttacctaaacagatcgattcgactaaagtgattgaagccatcttaccacataaagatgtt
gatggattccacccttataatgttgggcgtttatctcagcgtattcccactttacgccct
tgcacgccatacggtgtgatgaagttgcttgaaacaactggggtagatttatatggtcaa
cacgcagtgattgtaggtgcgtctaatattgttggtcgcccgatggcgttagaattgttg
cttggtggttgtacagtcacagttactcatcgctttaccaaagatttagagcatcacgtt
cgccaagcagatattttagttgtggcagtcggcaagcctgaatttattcccggggagtgg
gttaaagacggtgctatcgtgattgatgtagggattaaccgtggagcagacggcaaacta
aaaggtgatgtagagtattcagttgcctcacaaaaagcggcatttatcacccctgtcccc
ggtggggtaggcccgatgacggtggcaatgttaatgcaaaataccttgcagacgtatgaa
aaccatttacaagcggtctaa

DBGET integrated database retrieval system