KEGG   Mannheimia haemolytica M42548: MHH_c25520Help
Entry
MHH_c25520        CDS       T02635                                 

Definition
(GenBank) hypothetical protein
Organism
mhx  Mannheimia haemolytica M42548
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: AGK02986
Position
complement(2401477..2401674)
Genome map
AA seq 65 aa AA seqDB search
MARKIDAGVEIVEVDKRFIAKFFYDGKLQHTTYPQYNRQNAIMLINRKIERFNIGRDKPI
KLYKE
NT seq 198 nt NT seq  +upstreamnt  +downstreamnt
atggcacgaaaaattgatgccggtgttgagattgttgaggtagataaacgatttatcgcc
aagtttttttatgacggcaaattacagcacacaacctatccacaatacaaccgccaaaac
gcaattatgttgattaaccgcaaaattgagcggttcaacattggcagagacaaaccaatc
aaactttataaggaataa

DBGET integrated database retrieval system