KEGG   Mannheimia haemolytica M42548: MHH_c25550Help
Entry
MHH_c25550        CDS       T02635                                 

Definition
(GenBank) Abi-like protein
Organism
mhx  Mannheimia haemolytica M42548
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Abi_2
Motif
Other DBs
NCBI-ProteinID: AGK02989
Position
complement(2403121..2403858)
Genome map
AA seq 245 aa AA seqDB search
MLSKQVLSISESRLSTYLFCFFRNDPTKQKEAIAIYTALQHRTGIYFSLIQEIEVALRNE
VSQLLRFAAPNHNLYEFFHFLANDSNAPLNAESKRQLQKAISECGRNYNENDIISHISFG
FWVNLFNYDIKRNQYVAYWQSVLKPIFGHRFSNFKDLYNTLKQIMRFRNRLYHQEVVWNK
RIAKKPTHALENLEKTYKQFELALQKIAPERFAFRQLSQALIWQRQIFFDQQIFEAEIVI
LPQHI
NT seq 738 nt NT seq  +upstreamnt  +downstreamnt
atgttgtccaaacaagtgctaagtatttcagaaagtcggctgagtacatatttattttgc
tttttccgaaatgatcccacaaaacagaaagaagctattgcaatttataccgccttgcaa
catcgaacaggaatttatttttcattgattcaagaaatagaggtggcactaagaaatgaa
gtcagccagttgttacgctttgctgcacctaatcataatttatacgaattctttcatttt
ctagcgaacgatagtaatgctcctcttaatgcagaatctaaacgccagctacaaaaagcc
attagtgaatgcggacgtaactataatgaaaatgacataatttctcatatttcttttgga
ttttgggtaaatctgtttaattatgatataaagcgtaatcaatatgttgcttactggcaa
agcgtattaaagcctatttttggacatagatttagtaattttaaggatttatacaataca
ttaaagcaaattatgcgttttagaaatcggctgtatcatcaagaagtggtttggaataag
cgaattgccaagaaaccaacgcacgcactagagaatttagaaaaaacttacaagcaattt
gagttagcactacaaaagatagcacctgaacgatttgcgtttcgtcagctttcacaagca
cttatttggcaacgccaaatctttttcgaccaacaaatttttgaagctgaaatcgttatt
ttgccccaacatatctaa

DBGET integrated database retrieval system