KEGG   Mannheimia haemolytica M42548: MHH_c25590Help
Entry
MHH_c25590        CDS       T02635                                 

Definition
(GenBank) putative bacteriophage antirepressor
Organism
mhx  Mannheimia haemolytica M42548
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ANT Phage_pRha Phage_terminase
Motif
Other DBs
NCBI-ProteinID: AGK02993
UniProt: M9X8X1
Position
2405423..2406106
Genome map
AA seq 227 aa AA seqDB search
MNQLLNISAPKASITMSSREIAELCEKEHRHVTRDIEAMFSQLDIPAEGYAHFWTHPQNG
QTYREFRLPYDLTLTLISGYSVILRKKIIDRWQELESRQGIPQSFSQALRLAAEQQEVIE
QQNHQLAIQAPKVAFVEHYVEVGTTKSLRETAKILNFPEKRLIECLERYRVLYRQSGNLL
PYQDKQAKQLFAVKTGTAEHGHNFTQTRVTAKGIEWIAQRYASELGQ
NT seq 684 nt NT seq  +upstreamnt  +downstreamnt
atgaatcaattattaaacatttcggcaccaaaagcaagcattacgatgagtagtcgtgag
attgctgagttgtgcgaaaaagaacatcgacacgttactcgtgatatagaagcgatgttt
agtcaattagatattcctgccgaggggtatgcccatttttggacacaccctcaaaatggg
caaacataccgggaatttcgattgccttacgatttaacccttaccctaatttccggctat
agcgtgatacttcgcaagaaaattatcgaccgttggcaagagctagaaagcagacaaggt
attccacaatctttctctcaagctctacggttggcggcagaacagcaagaagtgattgag
cagcagaatcatcaattagccattcaagccccgaaagtcgcatttgtggagcattatgtt
gaggtgggaacgactaaatcattgcgagaaaccgccaagatactcaattttccagaaaag
cggttgattgaatgtttagaacgatatcgagttctttatcgccaatcaggaaacctactc
ccttatcaagataaacaagctaaacagctttttgcagtaaaaaccggcacggcagaacac
ggtcataattttacccaaacgagagtaaccgccaaagggattgaatggattgctcaacgt
tacgcatcggagttaggacaatga

DBGET integrated database retrieval system