KEGG   Mannheimia haemolytica M42548: MHH_c25710Help
Entry
MHH_c25710        CDS       T02635                                 

Definition
(GenBank) hypothetical protein DUF4035
Organism
mhx  Mannheimia haemolytica M42548
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF4035
Motif
Other DBs
NCBI-ProteinID: AGK03005
Position
2412815..2413045
Genome map
AA seq 76 aa AA seqDB search
MPERHFAEYQLFYQEQPFGLWREDYRAAQLAHLTAMINRDPKGKAPELSEFMPFFNRADE
VEANEDDGVADYLAKR
NT seq 231 nt NT seq  +upstreamnt  +downstreamnt
atgcctgaacgccactttgccgaatatcagcttttttatcaagagcaaccttttgggctt
tggcgtgaggactatcgtgctgctcaacttgcccacttaaccgcaatgatcaaccgtgac
ccaaaaggcaaagcccctgaactctcggaatttatgccgttttttaatcgggctgatgaa
gtagaagcaaatgaagatgatggcgttgcggattatttggcgaaaaggtaa

DBGET integrated database retrieval system