KEGG   Mannheimia haemolytica M42548: MHH_c25790Help
Entry
MHH_c25790        CDS       T02635                                 

Definition
(GenBank) bacteriophage tail protein
Organism
mhx  Mannheimia haemolytica M42548
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: OapA
Motif
Other DBs
NCBI-ProteinID: AGK03013
Position
2416634..2417245
Genome map
AA seq 203 aa AA seqDB search
MNLTKAESNLNAKITEEKKARVDADKVNADKLTDITSRVANAESTITNFQSTKANKSEVA
SLAQSSLQAVWKADAKSAVDSLSIGARNLLIDSTYNQHINYNTKMSSITRTVYRGNMLIR
LGMLGGAGVAGIVQAPAAQVSNIRQGQEYTLSLNVQGTAGIQKTGLNYVFLMRADGANQR
LATIPVIASLLNRPKIALGKMPV
NT seq 612 nt NT seq  +upstreamnt  +downstreamnt
gtgaacttgaccaaagcagagagcaatttaaatgccaaaatcacggaagaaaaaaaagct
cgtgttgatgcagataaagtgaatgcagataaactcacagacataacaagccgtgttgca
aatgcggaatcaactattaccaatttccaatcaaccaaagcgaataaaagtgaggttgcg
agccttgcacaaagttcgttgcaggcagtttggaaagctgatgcaaaatctgccgttgat
tcactttctatcggtgcaaggaacttactgatagacagtacttacaaccaacacatcaac
tacaatacaaaaatgtcatcaatcacacgcacagtctatcgcggcaatatgttgatacga
ctcggaatgcttggtggcgcaggtgtggccggtattgtacaagcaccagccgctcaagta
agtaatatcagacagggtcaagagtacacacttagcctgaatgtacagggtacagccggc
atacaaaaaacggggctcaactatgtattcttgatgcgtgctgatggggctaatcaacgg
ttagcaacaatacctgttatagccagcctattaaacagacctaaaatagcccttggcaaa
atgccggtgtaa

DBGET integrated database retrieval system