KEGG   Mannheimia haemolytica M42548: MHH_c25890Help
Entry
MHH_c25890        CDS       T02635                                 

Gene name
hflK
Definition
(GenBank) regulator protein HflK
  KO
K04088  membrane protease subunit HflK [EC:3.4.-.-]
Organism
mhx  Mannheimia haemolytica M42548
Module
mhx_M00742  Aminoglycoside resistance, protease FtsH
Brite
KEGG Orthology (KO) [BR:mhx00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    MHH_c25890 (hflK)
Enzymes [BR:mhx01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.-  Acting on peptide bonds (peptidases)
    3.4.-.-  
     MHH_c25890 (hflK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Band_7 HflK_N LptE
Motif
Other DBs
NCBI-ProteinID: AGK03022
Position
complement(2422057..2423280)
Genome map
AA seq 407 aa AA seqDB search
MSWNESGNQQDPWGKPGQKKAEPKPEQQEQGSQQEPTNNQRNEQQPPDLEEVFSSLLKKM
GGGKGPNNSSNQPSASLGKFLPVVLGLAAVVWVGSGFYTVQEAERGVVTRLGKLNDIVLP
GLNWKPTFIDSVTRVNVERVSELNTSGSMLTQDENMVQVEMTVQYRVEDPAKYLFSVSNP
DDSLKQATDSALRYVIGHMTMDEILTTGRATVRERTWSTLRDIIKTYDMGLLVTDVNFQY
ARPPEEVKAAFDDAIKAQEDEQRLIREAEAYARGEEPIARGQAQRTIEQAQAYKEAVVLN
AKGEVERLSQLLPEYKASPELTRERLYIQTMEKVMKNTPKVVMDSSGNNLNVLPFDKLMN
SSSVIKAEQPAAAQVVTPQVVQPQVQPRTQIQPQQAEQQEPTRKGRF
NT seq 1224 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtggaatgaatcaggcaatcagcaagatccttggggtaaaccggggcagaaaaaa
gctgagccaaagcctgagcaacaagaacagggttcacaacaagagccgaccaataatcaa
agaaatgaacaacagccccctgatttagaagaagtatttagcagtttattaaaaaaaatg
gggggtggaaaagggcctaataatagttcaaatcaacctagtgcaagcttagggaaattt
ctacctgtggttttaggtcttgcagcagtagtttgggttggctcaggtttttacactgtg
caagaggctgaacgtggtgtggttactcgtttaggtaagctgaatgatatcgtgttgcca
gggttgaattggaaaccgacttttattgattcggttacaagagtaaacgtagaacgtgtt
tcagagctgaacaccagtggctcaatgctgactcaagatgaaaatatggtgcaggtagaa
atgacggttcagtatcgtgtggaagacccggctaaatatctgtttagtgtgagcaaccct
gatgacagcttaaaacaagcaacagacagtgccttgcgttatgtgattggtcatatgacg
atggatgaaattttaaccacagggcgtgcaaccgtgcgtgaaagaacgtggtcgacattg
cgtgatattatcaaaacctatgatatgggtttattggtaacagacgtaaacttccaatat
gcacgaccgcctgaagaggtgaaagccgcctttgatgatgcaatcaaagcacaagaagat
gagcaacgcttaattcgtgaagcggaagcctatgcaagaggtgaagagccgattgcacgt
ggccaggcacagcgtacgattgagcaagctcaagcttacaaagaagcagttgtgttaaat
gcgaaaggggaagtggagcgtttgagtcaattattacctgaatataaagcctctccagag
ctgactcgtgaacgtttatatatccagacaatggaaaaagtcatgaaaaatacgccgaaa
gtggtgatggattcaagtggtaataatttgaatgtattgcctttcgataagctaatgaat
tcttcatcggtaataaaagcggagcagcctgcggcggcacaagtagttacaccacaagtt
gttcagccgcaagtacagccaagaacacaaattcagccgcaacaagcagaacaacaagaa
ccaactcgtaaggggagattttaa

DBGET integrated database retrieval system