KEGG   Mannheimia haemolytica M42548: MHH_c25930Help
Entry
MHH_c25930        CDS       T02635                                 

Definition
(GenBank) putative MetE-like homocysteine transmethylase
  KO
K00549  5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase [EC:2.1.1.14]
Organism
mhx  Mannheimia haemolytica M42548
Pathway
mhx00270  Cysteine and methionine metabolism
mhx00450  Selenocompound metabolism
mhx01100  Metabolic pathways
mhx01110  Biosynthesis of secondary metabolites
mhx01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:mhx00001]
 Metabolism
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    MHH_c25930
  Metabolism of other amino acids
   00450 Selenocompound metabolism
    MHH_c25930
Enzymes [BR:mhx01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.14  5-methyltetrahydropteroyltriglutamate---homocysteine S-methyltransferase
     MHH_c25930
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Meth_synt_2 Meth_synt_1
Motif
Other DBs
NCBI-ProteinID: AGK03026
UniProt: M9X323
Position
2427742..2428884
Genome map
AA seq 380 aa AA seqDB search
MSQLFPEATIRTQAPYRNDIVGSFLRTDALKKAREDFNQQKITRDELREVTRQEVKKLVE
LQKQHGVKAVSDGEFSRTWWHLDFLAELDGMDWQETEVFNVNFTGHKPKGQTVKIVGDID
FSESHPFVDAYRLLKEAAGDYPTKFTIPAPTMLHIICCVRAEDYQPLPQYQDEQKLYDDI
ANAYIKAMHKFYDMGLRNLQLDDTSWGQFCAEDKRKEFAARGFNLTDLAEKYVALLNRIV
DAKPADMSITMHICRGNFRSSWFSEGGYGPVAEVLFGKCRVDGFFLEYDTERAGTFEPLR
HIKDQQVVLGLITSKFGDLEDKNVIIERIKEAAQIVPINQLCLSPQCGFASTEEGNILTE
AAQWAKLNLIKEIAEEVWGS
NT seq 1143 nt NT seq  +upstreamnt  +downstreamnt
atgagccaattatttccggaagcaacaatccgcactcaagccccgtatcgtaatgatatt
gtaggcagctttctacgtaccgatgcgttaaaaaaagccagagaagatttcaatcagcaa
aaaatcacccgtgacgaattgcgtgaagtcacacgccaagaggtcaaaaaattagttgag
ttgcaaaagcaacacggtgtaaaagcagtctctgacggtgaatttagccggacttggtgg
catttagatttcttagctgaacttgatggaatggattggcaagaaaccgaagtctttaac
gtgaactttaccggtcataaacccaaagggcaaacggtaaaaatcgtgggcgatattgat
ttctccgaaagccacccttttgtggacgcttatcgtcttttaaaagaagctgccggcgat
tacccaaccaaattcacgattccggcaccgacaatgttacatattatctgctgtgtgcgt
gcggaagattaccaaccgttaccacaatatcaagacgaacaaaaactgtacgatgatatt
gctaatgcttatatcaaagcaatgcacaaattctacgatatggggctacgtaacttacaa
ttagacgacaccagttggggacaattctgtgccgaagataaacggaaagagtttgcagcc
agaggatttaatttaactgatttagcggaaaaatatgtcgcattattaaaccgtattgtt
gatgcaaaaccggcggatatgtcaattacgatgcacatctgccgtggtaacttccgttct
tcttggttctcggaaggcggttatggaccggttgccgaagtattattcggtaaatgccgt
gttgacggcttcttcttagaatacgataccgaacgtgcaggcactttcgagccactacgc
cacattaaagatcaacaagtggtactaggcttaattacctctaaatttggcgatttagaa
gataaaaatgtgatcattgagcgtattaaagaagcggctcaaattgtgccaatcaatcag
ctatgcttatcaccacaatgcggctttgcctccaccgaagaaggcaatattttaaccgaa
gccgcacaatgggcgaaactaaacttaattaaagaaattgcggaagaagtttggggtagc
taa

DBGET integrated database retrieval system