KEGG   Mycoplasma hyopneumoniae 232: mhp246
Entry
mhp246            CDS       T00206                                 
Name
(GenBank) conserved hypothetical protein
Organism
mhy  Mycoplasma hyopneumoniae 232
SSDB
Motif
Pfam: MFS_Mycoplasma MFS_1 DUF5392
Other DBs
NCBI-ProteinID: AAV27787
UniProt: P0C0K2
Position
complement(272912..274366)
AA seq 484 aa
MKKNFILNFATKNVKEKKLSFGVGITLWALIVFAYMIFVMNWGFASAGLNGKAGISGYLG
HFFPNANEAPGTVVNQAVNWGITIGRGIGSVLVGWLIVKISHKYTVILSLFFMLFGIIAP
YSPTYAGFIILRTIFAIGGTMQIILIQPVVSNYLNQRQKAVISQFSPFFYPIGTIITLIP
FAGIIGQEAQKAFRDNWQIVFLVIGLLTLIPLIGYIILGTKFDLYPSNIEKRNKQEKLSL
ATFFKQKDTWYWTILYGSWLVAVVFPFTFSKPIFHRLIGDSDGTFNDKISVFLIFFLAGM
FLGPFTIGLLSKYQLQRRKYISTIITLGVFFYVLATVVFVLKVGKNYEYAKSYTDGWTWL
FLFLGLFMGICLWGIQGVMLNLPHEYKGSNPYRVGFQFGLIWGLGYTAFTIATIITSLVN
TPPGIDLKKLELNNVDGYALGAYILIIIFSLVSSIGLALLKEPNPEYKKLLKIRSFSEIE
RIKK
NT seq 1455 nt   +upstreamnt  +downstreamnt
atgaaaaaaaattttattttaaacttcgcgacaaaaaacgtaaaagaaaaaaaattaagc
tttggagttggaataactttatgagctttaatcgtttttgcttatatgatttttgtaatg
aattgaggttttgcctctgccggacttaacggtaaagcgggaataagtggttatttaggt
cacttttttccaaatgctaatgaagccccaggaaccgttgtaaatcaagcagttaactgg
ggtatcacaattggtcgtggaattggatcagttcttgttggttgattaattgtgaaaatt
tcgcataaatatacagtaattttgtctttattttttatgctttttggaattattgcccct
tattcaccaacttatgccgggtttataattcttagaacaatttttgcaattggcggaaca
atgcagattattttaattcaaccagttgtctcaaattatttaaatcaaaggcaaaaagct
gttatttcacagttttccccttttttttatccaattggaacaataattacgcttattcct
tttgcaggaattattggtcaagaagctcagaaagcttttcgtgataattgacaaattgtc
tttttagttatcggacttcttaccttaattccattaattggatatatcattttaggtact
aaatttgatctttatccttcaaatattgaaaaaagaaacaaacaggaaaaactgagttta
gctacatttttcaaacaaaaagatacttgatattgaacaattttatatggttcttgactt
gtggcagtcgtttttccttttactttttcaaaaccaatttttcatcggttaataggtgat
agtgatggaacttttaatgataaaatttctgtttttctaatcttctttctagcaggaatg
tttcttggaccttttacaatcggacttttatccaaatatcagctacaaagacgtaaatat
atatcaacaattataactcttggcgtatttttttatgtgcttgcaactgttgtttttgtt
ttaaaagttggaaaaaattatgaatatgcaaaatcttatacggatggttgaacttgattg
ttcttatttttgggcctttttatgggaatttgtctttgaggaattcaaggggttatgcta
aatttacctcatgaatataaaggctcaaatccttaccgtgttggttttcagttcggtcta
atttggggtcttggctataccgcttttacaatcgcaacaattattacatcattagttaac
acgccaccaggaattgatctaaaaaaattagaactaaataatgtcgatggttatgctctt
ggagcttatattctcattattattttctcacttgtttcttcaattggtttagccctttta
aaagaaccaaatccagaatataaaaaattattaaaaatacgtagtttttctgaaattgaa
cgaatcaaaaaataa

DBGET integrated database retrieval system