KEGG   Mycoplasma hyopneumoniae 232: mhp269Help
Entry
mhp269            CDS       T00206                                 

Gene name
pfkA
Definition
(GenBank) 6-phosphofructokinase
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
mhy  Mycoplasma hyopneumoniae 232
Pathway
mhy00010  Glycolysis / Gluconeogenesis
mhy00030  Pentose phosphate pathway
mhy00051  Fructose and mannose metabolism
mhy00052  Galactose metabolism
mhy00680  Methane metabolism
mhy01100  Metabolic pathways
mhy01110  Biosynthesis of secondary metabolites
mhy01120  Microbial metabolism in diverse environments
mhy01130  Biosynthesis of antibiotics
mhy01200  Carbon metabolism
mhy01230  Biosynthesis of amino acids
mhy03018  RNA degradation
Module
mhy_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:mhy00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    mhp269 (pfkA)
   00030 Pentose phosphate pathway
    mhp269 (pfkA)
   00051 Fructose and mannose metabolism
    mhp269 (pfkA)
   00052 Galactose metabolism
    mhp269 (pfkA)
  09102 Energy metabolism
   00680 Methane metabolism
    mhp269 (pfkA)
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    mhp269 (pfkA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:mhy01009]
    mhp269 (pfkA)
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:mhy03019]
    mhp269 (pfkA)
Enzymes [BR:mhy01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     mhp269 (pfkA)
Protein phosphatases and associated proteins [BR:mhy01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     mhp269 (pfkA)
Messenger RNA biogenesis [BR:mhy03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     mhp269 (pfkA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK DAGK_cat
Motif
Other DBs
NCBI-ProteinID: AAV27490
UniProt: Q601D3
Position
295045..296013
Genome map
AA seq 322 aa AA seqDB search
MSKKIGILTSGGDAPGMNSAISFLAKSALSLGFEPYLIFDGYSGIIARKILPAKNFPYNG
ISSFGGTAIGSSRFPEFKKEEVQNKAVEILSEIGISSLVVVGGDGTYNGGYKLHLKGIKV
IALPGTIDNDIQFTDYTIGFDTALNTIVETIDKLRDTANSHRRCFVVEVMGRHCQDLALY
SAIATGSEILITNTNILTPEEVSQRVLEQFAKGKPSVIVTITENILPNLKEFAAKIEELT
KISTRSLEVGHTQRGGRPSAFDRILAAKMAMKAMELINQDKSGLAISYLDGKIQTFDIAK
VVSKPVRKTNDLVLEINKINQN
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
atgtcaaaaaaaatcggtatattaacttcaggcggtgatgcgcctgggatgaattctgca
ataagttttttggcaaaatcagcacttagtttaggttttgagccatatttaatttttgat
ggctattctggaataatcgcaagaaaaatattgccagcaaaaaattttccttataatgga
atttctagttttggcggaactgccataggatcaagtcgctttcctgaatttaaaaaagag
gaagttcaaaataaagccgttgaaattttaagtgaaattgggattagttcgcttgtggta
gttggtggcgatgggacctataatggcggttataaattacatttaaaaggaataaaagta
atcgctttaccaggaaccattgataatgatatccagtttactgattatacaattggattt
gatactgctttgaatacgatagttgaaactattgataaattaagggatacggcgaattct
catcgtcgttgttttgtagttgaagttatggggagacattgtcaagatttagctttatat
tcggcaatagcaactggaagcgaaattttaattactaatacaaatattttaacccctgaa
gaggtaagtcaaagagttttagaacagtttgcaaaaggcaaaccaagcgtgatagtaaca
attacagagaatattttaccaaacctaaaagagtttgcggctaaaattgaggagttaaca
aaaatttccactcgctctttagaagttggacatacccagcgcggcggcaggccttcagct
tttgaccgaattttagcagccaagatggcaatgaaagctatggaattaattaatcaagat
aaatcaggtcttgcaattagttatttagatggtaaaatccaaacttttgatattgcgaaa
gtagtatcaaaacctgttagaaaaacaaacgacttagtgctagaaattaataaaatcaat
caaaattaa

DBGET integrated database retrieval system