KEGG   Mycoplasma hyopneumoniae 232: mhp503Help
Entry
mhp503            CDS       T00206                                 

Gene name
aceF
Definition
(GenBank) dihydrolipoamide acetyltransferase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
mhy  Mycoplasma hyopneumoniae 232
Pathway
mhy00010  Glycolysis / Gluconeogenesis
mhy00020  Citrate cycle (TCA cycle)
mhy00620  Pyruvate metabolism
mhy01100  Metabolic pathways
mhy01110  Biosynthesis of secondary metabolites
mhy01120  Microbial metabolism in diverse environments
mhy01130  Biosynthesis of antibiotics
mhy01200  Carbon metabolism
Module
mhy_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:mhy00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    mhp503 (aceF)
   00020 Citrate cycle (TCA cycle)
    mhp503 (aceF)
   00620 Pyruvate metabolism
    mhp503 (aceF)
Enzymes [BR:mhy01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     mhp503 (aceF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh E3_binding
Motif
Other DBs
NCBI-ProteinID: AAV27595
UniProt: Q600F2
Position
634345..635265
Genome map
AA seq 306 aa AA seqDB search
MSKILATPKARAMAKHANIDLADLKIQHRKIEASDVENYIKSLKSAQTSAEKVEVSSSQQ
AEKTSIPASIPPKLEGKREKIAPIRKAIARAMTNSWNSVAYVNLVNQIDVSDLWKLRKSV
LDPVLKTSGVKLTFLAFIAKAILIALSEFPVMAAKYDEATSEIVYPDTLNLGLAVDTDAG
LMVPVIKDAQKLSIVEIAKEIVRLAKAARERKIKPSEMQGGSFTITNYGSVGSLYGVPVI
NYPELAIAGVGAIIDSAEVKDGQIVASKIMHLTVAADHRWIDGATIGRFAARVKELLEKP
EILGIL
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
atgtcaaaaattttagcaaccccaaaagcaagagcgatggcaaaacatgctaatattgat
cttgctgatcttaaaattcaacatcggaaaattgaagcttccgatgttgaaaattacata
aaatccttaaaatcagcacaaactagtgctgaaaaagtagaagtttcatcgtctcagcag
gctgaaaaaacttctattcccgcgtcaattccgcctaaattagaaggaaaacgcgagaaa
atcgctccaattcgaaaagcaattgcaagagcgatgactaattcttgaaattcagttgcc
tatgtcaacctcgttaatcaaattgacgttagcgatctttgaaaacttagaaaatcagtt
ttagaccctgtcctaaaaacatcaggtgtgaaactaacatttcttgcttttattgccaaa
gccattttgattgctcttagtgaatttcctgttatggcagcaaaatatgatgaagcaaca
agtgaaattgtctatcctgatactttaaatttaggtcttgctgtcgatactgacgccggg
cttatggttccagtaattaaggatgctcaaaagctttcaattgtagaaattgcaaaagaa
attgttcgtcttgccaaagctgcccgtgaacgtaaaattaaaccaagcgaaatgcaaggt
ggatcatttacaatcacaaattatggatcggttggttcactttatggtgttccagtaata
aattatcctgaactggcaattgctggagtaggagctattattgattcagccgaggtcaag
gatggtcaaattgttgcttcaaaaattatgcatttaacagttgctgcagatcatcgttga
attgatggtgcaacaattggtcgttttgctgcaagagttaaagaattattagaaaaacca
gaaattttaggaatcttataa

DBGET integrated database retrieval system