KEGG   Mycoplasma hyopneumoniae 168-L: MHP168L_402Help
Entry
MHP168L_402       CDS       T02675                                 

Definition
(GenBank) Methionyl-tRNA synthetase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
mhyl  Mycoplasma hyopneumoniae 168-L
Pathway
mhyl00450  Selenocompound metabolism
mhyl00970  Aminoacyl-tRNA biosynthesis
mhyl01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mhyl00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    MHP168L_402
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    MHP168L_402
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:mhyl01007]
    MHP168L_402
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:mhyl03016]
    MHP168L_402
Enzymes [BR:mhyl01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     MHP168L_402
Amino acid related enzymes [BR:mhyl01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   MHP168L_402
Transfer RNA biogenesis [BR:mhyl03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    MHP168L_402
 Prokaryotic type
   Other AARSs
    MHP168L_402
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1 tRNA-synt_1e tRNA-synt_1f tRNA-synt_1b TEX12
Motif
Other DBs
NCBI-ProteinID: AGM22179
Position
complement(489402..490943)
Genome map
AA seq 513 aa AA seqDB search
MTKKCYITTPIYYASGRLHIGHLYTTVLAWVIRNFKKMSGFEARLFTGSDEHGQKISQLA
AKANLEPQEFVDKNVENFKFLWEKFEIDYDYFQRTTNLNHKNFIKKIFLKMYEDNHIFNG
EYQGLYSISDEEFLSQSQAVYQNGNYFHPVSGAKMELISEKSYFFPIKKFQKWLEDFLLE
NPKFIFDSKIANELRQNFLQKGLEDLSVTRKNLKWGIFLDQKFENQTIYVWLDALFSYLS
VFKDQIDLENPKKSNFWTDSAQIIQVVGKEIARFHCIYWPIFLKSLNFRLPSIILTHGWL
ITPEGKMSKSKGNVINPLDLLKKFDPEIIKFYFVSQINTKNDSVFDENLLENFYNSFFVN
TFGNLISRTIALIVKKFDQPLLFEIADLDWTDISFYEKILLSLDEFCDNFDQLEIEKAFK
TVIELTKNLNGFFDIKQLWNQKNLKKLAQGLILVLNGIYAITVFLSIAMPKKTNEILEFL
GIRQKNFLLITKLDKFDKINFKKLEKPFFPRKN
NT seq 1542 nt NT seq  +upstreamnt  +downstreamnt
atgactaaaaaatgttatatcacaactccaatttattatgctagcgggagactccatatt
gggcatctttatacaacagtgcttgcttgagtaattagaaattttaaaaaaatgtccgga
tttgaggctagattgtttactggttctgatgaacatggtcaaaaaatttctcaactagct
gcaaaagcaaatcttgaaccccaagaatttgttgataaaaatgtcgaaaatttcaaattt
ttatgagaaaaatttgaaatcgactatgattattttcaaagaacaacaaatttaaatcat
aaaaattttatcaaaaaaatttttctaaaaatgtatgaagataatcatattttcaatggt
gaataccaagggctttattcgataagcgatgaggaatttctcagtcaaagtcaagctgtt
tatcaaaatggaaactattttcaccctgttagcggggcaaaaatggaattaataagtgag
aaatcctacttttttccaatcaaaaaattccaaaaatgactagaggattttcttttggaa
aatcccaaattcatttttgattcaaaaatcgcaaatgaattaaggcagaattttttacaa
aagggacttgaagacttatcagtgacaagaaaaaatctaaaatgaggtatttttcttgat
caaaaatttgaaaatcagacaatttatgtttgacttgatgcactttttagttatttatca
gtttttaaagaccaaattgatttagaaaatcctaagaaatcaaatttttgaactgattct
gcacaaattattcaagtagttggcaaagaaattgcccgttttcactgtatttattggcca
atttttctaaaatcgctcaattttcgccttccaagcataattttaactcacggttgacta
atcacccctgagggaaaaatgtcaaaatcaaaaggaaatgtgataaatccacttgatttg
ctaaaaaaatttgatccagaaattattaaattttattttgtcagccaaataaacactaaa
aatgatagtgtttttgatgaaaatttattagaaaatttttataattctttttttgtaaac
acttttggtaatttaataagcagaacaattgccttgatagtgaaaaaatttgatcagcct
ttattatttgaaattgcagatcttgattgaacagatattagtttttatgagaaaatcctg
cttagtttagatgaattttgcgataactttgatcaactagaaattgaaaaagcctttaaa
acagtaattgaattaacaaaaaatttaaacggcttttttgatattaaacaactttgaaat
caaaaaaatttgaaaaaactggcccaaggtttaattttggttctcaatggaatttatgct
ataactgtttttttaagcatcgcaatgcctaaaaaaactaacgaaattcttgaatttctt
ggaattagacagaaaaactttttacttattactaaattagataaatttgataaaattaat
ttcaaaaaattagaaaaaccattttttcctcgaaaaaattaa

DBGET integrated database retrieval system