KEGG   Methanomethylovorans hollandica: Metho_0947Help
Entry
Metho_0947        CDS       T02418                                 

Definition
(GenBank) geranylgeranyl reductase family protein
  KO
K17830  digeranylgeranylglycerophospholipid reductase [EC:1.3.1.101 1.3.7.11]
Organism
mhz  Methanomethylovorans hollandica
Pathway
mhz00564  Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:mhz00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    Metho_0947
Enzymes [BR:mhz01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.101  2,3-bis-O-geranylgeranyl-sn-glycerol 1-phosphate reductase [NAD(P)H]
     Metho_0947
   1.3.7  With an iron-sulfur protein as acceptor
    1.3.7.11  2,3-bis-O-geranylgeranyl-sn-glycero-phospholipid reductase
     Metho_0947
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_3 FAD_binding_2 FAD_oxidored HI0933_like NAD_binding_8 Pyr_redox_2 Lycopene_cycl GIDA DAO Trp_halogenase Thi4 Pyr_redox_3 3HCDH_N Pyr_redox
Motif
Other DBs
NCBI-ProteinID: AGB49188
UniProt: L0KYN3
Position
complement(936260..937468)
Genome map
AA seq 402 aa AA seqDB search
MKDNYDIIVVGAGPAGSITAKTAAKKGLSVLLIEKRQEIGDPVRCAEGISKIALKKHIEP
DPRWICADMKGSRIFSPDGTSVQMAEEIAGGEVGYVLERKIFDRALVYESVKAGAEVMVK
TRATGLIIENGYVCGIKAMHLGKEYKIRSKIVIGADGMESKVGRWAGIDTSLKPSDMETC
VQYLMSGVNIDQEYCQFYVGKKIAPCGYLWLFPKGGNMANVGIGILGSESGEKRAIDYLN
EFVKEKLPDASIIEIDYGGVPVSGTVERTIANGLMLVGDAARQSDPVTGGGIINAMDAGE
IAGEVACNAILAGDVSIKSLQEYEDRWRATIGKAIDNGLIVKDLFVKFTDEELNSLAYSL
KDVNFNKMSLTDLLYALFKANKKLLWDLRVLFKNVVKNEMDM
NT seq 1209 nt NT seq  +upstreamnt  +downstreamnt
atgaaagataattacgatatcatcgttgtaggtgccggacctgctggttcaattacagca
aaaaccgcagccaagaagggccttagcgtgctacttatagaaaaacgccaggagattggt
gatccagtaagatgcgcagaaggtatcagcaaaatagccttgaaaaagcatatcgaaccg
gatccaagatggatatgtgccgacatgaaaggatcaagaatattctctcctgatggcacg
agtgtacagatggctgaagagatagccggcggagaagtcggttatgtcctggaaagaaag
atatttgaccgggcacttgtctatgaaagtgtaaaggcaggcgccgaagtcatggtcaag
accagagctacaggtctgattattgaaaatggatacgtatgcggcatcaaagccatgcac
cttggaaaggaatataagatccggtccaagatagtgatcggtgcagatggtatggaatcc
aaggtcggcagatgggcaggtatcgatacttctctaaaaccttcggacatggagacctgt
gtgcagtatcttatgagcggtgtcaatatcgatcaggaatactgccagttctatgtgggt
aagaaaatagcaccttgtggctatctctggttattccctaaaggcgggaatatggccaat
gtgggtatcggtatacttggaagcgaatctggtgaaaaaagagccatagactacctcaat
gaatttgtaaaagaaaaacttccggacgcttctattattgaaattgattatggtggcgta
cctgtaagtggaacagttgaacgtaccatcgccaatgggctcatgctggtaggtgatgca
gcaaggcaatccgatccagttacaggcggaggtatcataaatgccatggacgcaggcgag
atagcaggtgaagtggcttgtaatgcaatacttgcgggcgatgtttccataaaatctctc
caggaatatgaagaccgatggagagcaacgattggcaaggcaatagataacggtctgatc
gtcaaggacctttttgtgaaattcacggatgaagaactgaattctctggcgtattcctta
aaggatgtgaacttcaacaaaatgagccttactgacttgctatatgcacttttcaaagcc
aataaaaaactgttgtgggatttgagagtgttattcaagaatgtcgtgaagaatgaaatg
gacatgtaa

DBGET integrated database retrieval system