KEGG   Mycobacterium intracellulare ATCC 13950: OCU_04630Help
Entry
OCU_04630         CDS       T02158                                 

Definition
(GenBank) 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase
  KO
K00950  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
mia  Mycobacterium intracellulare ATCC 13950
Pathway
mia00790  Folate biosynthesis
mia01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mia00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    OCU_04630
Enzymes [BR:mia01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     OCU_04630
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HPPK
Motif
Other DBs
NCBI-ProteinID: AFC41683
UniProt: H8IN96
Position
462888..463397
Genome map
AA seq 169 aa AA seqDB search
MVLSIGSNLGDRLARLQSVVDGLGDTVLAVSPVYETDPWGRVDQAPFLNAVLIADDPACD
GQGWLARAQEFERAAGRVRGERWGPRTLDVDLIACYGQTEVTSRENNLTLPHPLAHLRAF
VLIPWLAVDPDARLTVAEGPRPVAQLLAELEPADRAAVRRSDLTLELTT
NT seq 510 nt NT seq  +upstreamnt  +downstreamnt
gtggtgttgtccatcgggtccaacctgggggaccggctggcgcggttgcagtcggtcgtc
gacgggctgggggacacggtgctcgccgtgtcaccggtgtacgagaccgacccttggggc
cgggtcgatcaggcgccgttcctcaacgcggtgctgatcgccgacgacccggcctgcgac
gggcagggctggctggcccgggcgcaggagttcgagcgcgcggcgggcagggtccgcggc
gagcgctgggggccgcgcaccctcgacgtcgacctgatcgcctgttacgggcaaaccgag
gtgacctcgcgggagaacaacctgacgctgccgcatccgctggcccatttgcgggccttc
gtgctgatcccctggctggccgtcgacccggacgctcggctgacggtcgccgaagggccg
cgtcccgtcgcgcagttgctggccgaactggagcccgccgaccgtgccgccgtacggcgc
tccgacctgacgctcgagctcacaacctga

DBGET integrated database retrieval system