KEGG   Mycobacterium intracellulare ATCC 13950: OCU_04850Help
Entry
OCU_04850         CDS       T02158                                 

Definition
(GenBank) cysteinyl-tRNA synthetase
  KO
K01883  cysteinyl-tRNA synthetase [EC:6.1.1.16]
Organism
mia  Mycobacterium intracellulare ATCC 13950
Pathway
mia00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:mia00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    OCU_04850
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:mia01007]
    OCU_04850
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:mia03016]
    OCU_04850
Enzymes [BR:mia01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.16  cysteine---tRNA ligase
     OCU_04850
Amino acid related enzymes [BR:mia01007]
 Aminoacyl-tRNA synthetase
  Class I (G)
   OCU_04850
Transfer RNA biogenesis [BR:mia03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    OCU_04850
 Prokaryotic type
    OCU_04850
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1e tRNA-synt_1g tRNA-synt_1f DALR_2 tRNA-synt_1
Motif
Other DBs
NCBI-ProteinID: AFC41705
UniProt: H8INB8
Position
483646..485007
Genome map
AA seq 453 aa AA seqDB search
MRDFVPLREGHVSIYLCGATVQGLPHIGHVRSGVAFDILRRWLIARGCDVAFIRNVTDID
DKILNKAAAANRPWWEWAATYERAFSAAYDALDVLPPSAEPRATGHITQMIELMHRLIET
EHAYAAGGDVYFDVLSYPEYGQLSGHKIDDVHQGEGAATCKRDQRDFTLWKAAKPGEPSW
PTPWGRGRPGWHLECSAMARTYLGAEFDIHCGGMDLVFPHHENEIAQSRAAGDGFARYWL
HNGWVTMGGEKMSKSLGNVLAIPALLQRVRPAELRYYLGSAHYRSMLEFSETALQDAVKA
YVGVEEFLHRVRVRVGGVEPGQWTPKFADALNDDLAVPAALAEVHAARAEGNRALDSGDH
DGALRHARAIRAMMGILGCDPLDERWETRDETSAALAAVDVLVHAELENREKAREQRNWA
LADEIRDRLKHAGIEVTDTADGPQWSLQAGPDQ
NT seq 1362 nt NT seq  +upstreamnt  +downstreamnt
gtgcgtgatttcgtgccgctgcgcgagggccacgtctccatctacctttgcggcgccacc
gtgcagggcctgccgcacatcggccacgtccgcagcggggtggccttcgacatcctgcgc
cgctggctgatcgcccgcgggtgcgacgtcgccttcatccgcaacgtcaccgacatcgac
gacaagatcctcaacaaggccgccgcggcgaacaggccgtggtgggagtgggcggccacc
tacgaacgcgccttctccgccgcctacgacgccctggacgtgctgccgccgtcggccgag
ccgcgggccaccggccacatcacccagatgatcgagttgatgcaccgcctgatcgaaacc
gagcacgcgtacgccgccggcggcgacgtctacttcgacgtgctcagctacccggagtac
gggcaactgtccggccacaagatcgacgacgtccatcagggcgagggcgcggccacctgc
aaacgcgaccagcgcgacttcaccctgtggaaggccgccaagcccggcgagccgtcctgg
cccacgccgtggggccgcggccgcccgggctggcacctggaatgctcggcgatggcccgc
acctacctgggcgccgaattcgacatccattgcggcggaatggatttggtcttcccgcat
cacgagaacgagatcgcccagagccgcgccgccggcgacggcttcgcccgctactggctg
cacaacggctgggtgacgatgggcggcgagaagatgagcaagtcgctgggcaacgtcctg
gccatcccggcgctgctgcagcgggtccggcccgccgagttgcgctactacctgggcagc
gcccactaccggtcgatgctggaattctccgagaccgccctgcaggacgcggtgaaagcc
tatgtgggcgttgaggaattcctgcaccgggtgcgggttcgggtcggcggcgtcgagccc
ggccagtggacgccgaagttcgccgacgcgctcaacgacgacctggcggtgccggcggcg
ctggccgaggtgcacgccgcccgcgccgagggcaaccgggcgctggactccggcgatcac
gacggcgcgctgcgccacgcccgggcgatccgcgcgatgatgggcatcctgggctgcgac
cccctcgacgagcgctgggagacccgcgacgagacgtcggcggcgctggccgccgtcgac
gtgctggtgcacgcggagctggagaaccgggagaaggcgcgcgagcagcgcaactgggcg
ctcgccgacgagatccgggaccggctcaagcacgccggcatcgaggtcaccgacaccgcc
gacgggccgcagtggtcgctgcaggccggcccggatcagtag

DBGET integrated database retrieval system