KEGG   Mycobacterium intracellulare ATCC 13950: OCU_35220Help
Entry
OCU_35220         CDS       T02158                                 

Definition
(GenBank) enoyl-CoA hydratase
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
mia  Mycobacterium intracellulare ATCC 13950
Pathway
mia00071  Fatty acid degradation
mia00280  Valine, leucine and isoleucine degradation
mia00281  Geraniol degradation
mia00310  Lysine degradation
mia00360  Phenylalanine metabolism
mia00362  Benzoate degradation
mia00380  Tryptophan metabolism
mia00410  beta-Alanine metabolism
mia00627  Aminobenzoate degradation
mia00640  Propanoate metabolism
mia00650  Butanoate metabolism
mia00903  Limonene and pinene degradation
mia00930  Caprolactam degradation
mia01100  Metabolic pathways
mia01110  Biosynthesis of secondary metabolites
mia01120  Microbial metabolism in diverse environments
mia01130  Biosynthesis of antibiotics
mia01212  Fatty acid metabolism
Module
mia_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:mia00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    OCU_35220
   00650 Butanoate metabolism
    OCU_35220
  Lipid metabolism
   00071 Fatty acid degradation
    OCU_35220
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    OCU_35220
   00310 Lysine degradation
    OCU_35220
   00360 Phenylalanine metabolism
    OCU_35220
   00380 Tryptophan metabolism
    OCU_35220
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    OCU_35220
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    OCU_35220
   00281 Geraniol degradation
    OCU_35220
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    OCU_35220
   00627 Aminobenzoate degradation
    OCU_35220
   00930 Caprolactam degradation
    OCU_35220
Enzymes [BR:mia01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     OCU_35220
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_1 ECH_2
Motif
Other DBs
NCBI-ProteinID: AFC44741
UniProt: H8IWV5
Position
3754662..3755411
Genome map
AA seq 249 aa AA seqDB search
MTDEILLIHTEERVRTLTLNRPQSRNALSSALRDRFFGALADAETDDDVDVVIVTGTDPV
FCAGLDLKELGGSSALPDISPRWPAMTKPVIGAINGAAVTGGLELALYCDILIASENARF
ADTHARVGLLPTWGLSVRLPQKVGIGLARRMSMTGDYLSAADALRAGLVTEVVPHERLLG
AARQVAASIVGNNQDAVRALLASYHRIDDAQTGAGLWQEAMAARQFRTSGDDIAANREAV
LQRGRAQVR
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
atgaccgacgagatcctgctgatccacaccgaggaacgggtccgcaccctgaccctgaac
cgaccccaatcgcgcaacgcgctgtcctcggcgttgcgggaccgcttcttcggcgcgctg
gccgacgccgaaaccgacgacgacgtcgacgtcgtcatcgtcaccggcaccgacccggtg
ttctgcgcgggactcgatctcaaggagctcggcggctcgtcggcgctgccggacatctcg
ccgcggtggccggcgatgaccaagccggtgatcggcgccatcaacggcgccgcggtgacc
ggcgggctggagctggcgctgtactgcgacatcctgatcgcctcggagaacgcccgcttc
gccgacacgcacgcccgggtgggcctgctgcccacatgggggctgagcgtgcggttaccg
cagaaggtgggcatcggcctggcccggcggatgagcatgaccggcgactacctgtccgcc
gccgacgcgctgcgcgccggcctggtgaccgaggtggtgccccacgagcggctgctgggt
gccgcgcgccaggtcgccgcgtcgatcgtggggaacaaccaggacgcggtgcgggcgctg
ctggcgtcctatcaccgcatcgacgacgcgcagaccggcgcggggctctggcaggaggcg
atggcggcccggcaattccggaccagcggcgacgacatcgccgccaaccgcgaggccgtg
ctgcaacgcgggcgggcccaggttcgctga

DBGET integrated database retrieval system