KEGG   Mycobacterium intracellulare ATCC 13950: OCU_35380Help
Entry
OCU_35380         CDS       T02158                                 

Definition
(GenBank) chelatase
  KO
K03404  magnesium chelatase subunit D [EC:6.6.1.1]
Organism
mia  Mycobacterium intracellulare ATCC 13950
Pathway
mia00860  Porphyrin and chlorophyll metabolism
mia01100  Metabolic pathways
mia01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mia00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    OCU_35380
Enzymes [BR:mia01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     OCU_35380
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: VWA_2 AAA_5 VWA Mg_chelatase MCM VWA_3 Sigma54_activat AAA AAA_3 AAA_29
Motif
Other DBs
NCBI-ProteinID: AFC44757
UniProt: H8IWX1
Position
complement(3771829..3773670)
Genome map
AA seq 613 aa AA seqDB search
MRPYPFSAIVGHDQLRLALLLCAVRPEIGGALIRGEKGTAKSTAVRGLAALLCAATGSDS
GLVEMPLGATEDRVIGSLDLQRVLRDGEHAFSPGLLARAHGGVLYVDEVNLLHDHLVDVL
LDAAAMGRVHIERDGISHSHEARFVLIGTMNPEEGELRPQLLDRFGLTVDVHASRDVDVR
VQVIRQRMAYEADPDGFAERYAAADAELARRIAAARALVDDVALPDNELRRIAALCAAFD
VDGMRADLVVARTAVAHAAWRGAPAVEEQDIRVAAELALPHRRRRDPFDDPGIDRDQLDE
ALAQAGSEPDPEPDPPGGGQTPDTEQAGPQRDSGDSTTAKPPKSKPSAPPSKTFRTRALR
VPGVGEGAPGRRSRARNAGGSVIAATDGDDTSCGGHGLHVFATLLSAAERAGAGPLRPGP
DDVRRAVREGREGNLVIFVVDASGSMAARDRMAAVSGATLSLLRDAYQRRDKVAVITFRH
QQAQLLLPPTSSAHIAGRRLARFDTGGKTPLAEGLLAARELIVREKARDRARRALVVVLT
DGRATAGPDPLGRTRSAAARLVAEGAAAVVVDCETSFVRLGLAEQLARQLGAPAVRLEQL
HADSLTRAVRDVA
NT seq 1842 nt NT seq  +upstreamnt  +downstreamnt
gtgaggccctacccgttcagcgccatcgtcgggcacgaccagctgcgtctcgccctgctg
ttgtgcgccgtgcgccctgagatcgggggcgccctcatccgcggcgagaagggcaccgcc
aagtcgacggccgtgcgcggcctggcggcgctgctgtgcgcggcgaccggcagcgattcc
ggcctggtcgaaatgccgctcggggcaaccgaagacagggtcatcggctcgctggatctg
cagcgggtgctgcgcgacggcgagcacgctttttccccgggcctgttggcccgcgcgcac
ggcggggtgctctacgtcgacgaggtcaacctgctgcacgatcatctcgtcgacgtgctg
ctcgacgccgcggcgatggggcgggtgcacatcgaacgcgacggcatctcgcattcgcat
gaggcgcggttcgtgttgatcggcaccatgaatcccgaagagggcgaactgcgtccgcag
ctgttggaccgcttcgggctcaccgtcgacgtgcacgcctcacgcgacgtcgacgtgcgg
gtgcaggtcatccggcagcgaatggcgtatgaggccgacccggacggcttcgcggagcga
tacgccgccgccgacgccgagctggcccggcgcatcgccgcggcccgcgcgctcgtcgac
gatgtggcgttgcccgacaacgagttacggcgcatcgcggcgctgtgcgcggcgttcgat
gtcgacggcatgcgcgcggacctggtggtggcccgcaccgccgtcgcccacgccgcctgg
cgcggggcgcccgccgtcgaggaacaggacatccgggtcgccgccgagctggcgctgccg
caccggcgccgccgcgaccccttcgacgatccggggatcgaccgcgaccagctggacgaa
gccctggcgcaggccggctccgagccggaccccgagcccgacccgcccggcggcggtcaa
acgccggacaccgaacaggctgggccacaacgggactcgggggacagcaccacggcgaag
ccgccgaagtccaagcccagcgcgcctccgtcgaaaaccttccgcacccgcgcgctgcgc
gtccccggggtgggggagggcgcgcccgggcggcggtcgcgggcgcgcaacgccggcggc
agcgtcatcgccgccaccgacggggacgacaccagttgcggcgggcacggactgcacgtg
ttcgccacgctgctctcggccgccgagcgcgccggggccgggccgctgcggcccgggccc
gacgacgtgcgccgcgccgtgcgcgagggacgcgagggcaacctggtgatcttcgtggtg
gacgcctccggttcgatggccgcccgcgaccggatggcggcggtcagcggcgccacgctg
tcgctgctgcgcgacgcctaccagcgccgcgacaaggtcgccgtgatcaccttccggcac
cagcaggcgcaattgttgctaccgccgacctcctcggcccacatcgccgggcggcgactg
gcccgcttcgacaccggcggcaagacgccgctcgccgaaggcctgctggccgcgcgcgag
ctgatcgtccgggagaaggcgcgcgaccgggcccgccgcgccctggtggtggtgctcacc
gacggccgggccaccgcaggaccggatccgttgggccgcacccgatccgcggcggcccgg
ctggtggccgaaggcgcggccgcggtggtcgtggattgcgagacgtcgttcgtgcggctg
ggcctggccgagcagctggcccgccaactcggcgcacccgccgttcggctggagcagctg
cacgccgattcattgacgcgtgcggtacgcgacgtggcgtga

DBGET integrated database retrieval system