KEGG   Mycobacterium intracellulare ATCC 13950: OCU_37750Help
Entry
OCU_37750         CDS       T02158                                 

Definition
(GenBank) beta-ketoadipyl CoA thiolase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
mia  Mycobacterium intracellulare ATCC 13950
Pathway
mia00071  Fatty acid degradation
mia00072  Synthesis and degradation of ketone bodies
mia00280  Valine, leucine and isoleucine degradation
mia00310  Lysine degradation
mia00362  Benzoate degradation
mia00380  Tryptophan metabolism
mia00620  Pyruvate metabolism
mia00630  Glyoxylate and dicarboxylate metabolism
mia00640  Propanoate metabolism
mia00650  Butanoate metabolism
mia00900  Terpenoid backbone biosynthesis
mia01100  Metabolic pathways
mia01110  Biosynthesis of secondary metabolites
mia01120  Microbial metabolism in diverse environments
mia01130  Biosynthesis of antibiotics
mia01200  Carbon metabolism
mia01212  Fatty acid metabolism
mia02020  Two-component system
Brite
KEGG Orthology (KO) [BR:mia00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    OCU_37750
   00630 Glyoxylate and dicarboxylate metabolism
    OCU_37750
   00640 Propanoate metabolism
    OCU_37750
   00650 Butanoate metabolism
    OCU_37750
  09103 Lipid metabolism
   00071 Fatty acid degradation
    OCU_37750
   00072 Synthesis and degradation of ketone bodies
    OCU_37750
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    OCU_37750
   00310 Lysine degradation
    OCU_37750
   00380 Tryptophan metabolism
    OCU_37750
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    OCU_37750
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    OCU_37750
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    OCU_37750
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mia04147]
    OCU_37750
Enzymes [BR:mia01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     OCU_37750
Exosome [BR:mia04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   OCU_37750
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_C Thiolase_N ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: AFC44994
UniProt: H8IKB7
Position
4006959..4008107
Genome map
AA seq 382 aa AA seqDB search
MHPQALLARCLTALAERTDFDPVDVDDVIAGNGILSGDHGDDIARMSVLLAGWPETVPGM
TLSRFCGSGQQAVTVAAAGIAAGSEDLVIAGGVESMSRWGVTAGVPTIDGNNPDLRAVYP
TVPQGISADLIATLEGFGREVVDAYAAQSQSRAAVAIEERRFDRSLVDVAAPAGRVEHDE
HPRPGTTTETLSRLKPAFEAMGAARADGEQRTFDEICLERYPGVDRIDHVHHAGNSSGVV
DGAAAVLLASSNWMHTHRVTPRAQIRATAAIGSEPIIMLTAPGPAAQRCLERAGMTVADI
DLWEINEAFAAVPLKTMRDLDIDPDVVNVNGGAIALGHPIGATGAMLIGTVLDELERRDL
TTGLVTMCTGGGMGTATIIERV
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
gtgcacccgcaggccttgctcgcgcgctgcctcaccgcactggccgagcggaccgacttc
gatccggtcgacgtcgatgacgtgatcgccggcaacggcatcctcagcggggaccacggc
gacgacatcgcccgaatgtccgtgctgttggcggggtggccggagaccgtgccggggatg
acgttgagccggttctgcggctcgggccagcaggccgtcaccgttgcggcggcgggcatc
gccgccggcagtgaggatttggtgatcgccggcggtgtcgagtcgatgtcgcggtggggg
gtgacggccggggtcccgacgatcgacggcaacaatcccgatcttcgcgcagtgtacccg
actgtgccacaaggcatttcggccgatctgatcgcgaccctggagggattcggccgcgag
gtcgtcgacgcctacgctgcgcagagccagagccgcgccgccgtggccatcgaggagcgg
cgcttcgatcgttccctggtcgacgtggccgcacccgccggccgcgtggaacacgacgag
catccgcgcccgggcaccaccactgagacgctgtcacgcctcaaaccggccttcgaggcg
atgggggccgcgcgcgccgacggcgagcaacgcacgttcgacgaaatttgcctcgagcgc
tatcccggcgtcgaccgcatcgatcacgtgcaccacgcgggcaattcgtccggcgtggtc
gacggcgccgccgccgtactgctcgcctcctccaactggatgcacacccaccgcgtgacc
ccgcgggcgcagatccgggcgaccgcggccatcggcagcgaaccgatcatcatgctcacc
gcgcccggccccgcggcgcagcggtgcctggaacgcgccggcatgacggtggccgacatc
gatctgtgggagatcaacgaggccttcgccgcggtcccgctcaagacgatgcgcgatctg
gacatcgatcccgacgtggtcaatgtcaacggcggcgcgatcgccctcgggcacccgatc
ggcgccaccggcgccatgctgatcggcaccgttctcgacgaactcgaacgtcgtgacctg
acaacgggactggtgaccatgtgcacgggcggcgggatgggcacggcgacgatcatcgag
cgggtgtga

DBGET integrated database retrieval system