KEGG   Mycobacterium intracellulare ATCC 13950: OCU_42430Help
Entry
OCU_42430         CDS       T02158                                 

Definition
(GenBank) hypothetical protein
Organism
mia  Mycobacterium intracellulare ATCC 13950
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: AFC45462
UniProt: H8IQQ6
Position
4476866..4477048
Genome map
AA seq 60 aa AA seqDB search
MVRPPTCRKACPGTPTGTASGGRPGPIRPVPSHSCHRHNRREFFHLMCARRFRSRHRGRA
NT seq 183 nt NT seq  +upstreamnt  +downstreamnt
atggttaggccgcccacctgcaggaaggcgtgcccgggcaccccgactgggacggcctcg
ggtggacgtcctggaccaatccgcccagtccccagccattcatgtcaccgtcataaccgg
cgggagttctttcatctgatgtgcgcgcgacgttttcgttcacgtcatcgcggccgcgct
taa

DBGET integrated database retrieval system