KEGG   Mycobacterium intracellulare ATCC 13950: OCU_42460Help
Entry
OCU_42460         CDS       T02158                                 

Definition
(GenBank) hypothetical protein
Organism
mia  Mycobacterium intracellulare ATCC 13950
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SnoaL_2 SnoaL
Motif
Other DBs
NCBI-ProteinID: AFC45465
UniProt: H8IQQ9
Position
4478352..4478702
Genome map
AA seq 116 aa AA seqDB search
MSSAHALYARWITELWNGRPVAAELVTDDFVGHWPGREVRGPDALAQIIEQTRNMFSDLS
FAIVVGPLTEGDLVAGRWVGTGHGPDGPVSFTGNDILRLAADGRRFAEYWTGTSAG
NT seq 351 nt NT seq  +upstreamnt  +downstreamnt
atgtcgagcgcgcacgcgctgtacgcccgctggatcaccgaactctggaacggacggccg
gtcgcggccgagctggtcaccgacgacttcgtcggtcactggcccggccgggaggtacgg
ggaccggacgcgctcgcgcagatcatcgagcagacacgaaacatgttctcggacttgagc
ttcgccatcgtggtcggcccgctgaccgagggtgatctggtggccgggcgctgggtgggc
accggccacggcccggacggcccggtctcgttcaccggcaacgacatcctgcgcctggcc
gccgacggccggcggttcgccgagtactggacgggcacttccgcgggctga

DBGET integrated database retrieval system