KEGG   Mycobacterium intracellulare ATCC 13950: OCU_42510Help
Entry
OCU_42510         CDS       T02158                                 

Definition
(GenBank) 30S ribosomal protein S9
  KO
K02996  small subunit ribosomal protein S9
Organism
mia  Mycobacterium intracellulare ATCC 13950
Pathway
mia03010  Ribosome
Module
mia_M00178  Ribosome, bacteria
Brite
KEGG Orthology (KO) [BR:mia00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    OCU_42510
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:mia03011]
    OCU_42510
Ribosome [BR:mia03011]
 Ribosomal Proteins
  Mitochondria/ Chloroplast
   Small subunit
    OCU_42510
  Bacteria
    OCU_42510
  Archaea
    OCU_42510
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_S9
Motif
Other DBs
NCBI-ProteinID: AFC45470
UniProt: H8IQR4
Position
complement(4483046..4483585)
Genome map
AA seq 179 aa AA seqDB search
MTETTEGLENPENPDNPETAEETVAVAEVTEAPVEASEPADVAAPAEPYVFERPIQTVGR
RKEAVVRVRLVPGTGQFNLNGRTLEGYFPNKVHQQLIKAPLVTVDRVESFDVYAHLHGGG
PSGQAGALRLGIARALIVASPDDRPALKKAGFLTRDPRATERKKYGLKKARKAPQYSKR
NT seq 540 nt NT seq  +upstreamnt  +downstreamnt
gtgaccgaaacgaccgagggcctggagaacccagagaacccggacaacccagagaccgca
gaggaaacagtggccgtcgccgaggtgaccgaagccccggtcgaggcctcggagcccgcc
gacgtcgccgcgcccgccgagccctacgtgttcgaacggcccatccagaccgtcggccgc
cgcaaggaggccgtggtgcgggtgcgcctggtgcccggcaccggccagttcaacctgaac
ggccgcaccctggagggctacttccccaacaaggtgcaccagcagctcatcaaggccccg
ctggtcaccgtggaccgggtggagagcttcgacgtctacgcccacctgcacggcggcggc
ccctcggggcaggccggcgcgctgcgcctgggcatcgcgcgggcgctcatcgtggcctcg
ccggacgaccgtcccgcgctgaagaaggccgggttcctcacccgtgacccgcgcgccacc
gagcgcaagaagtacggcctgaagaaggcccgcaaggcgcctcagtacagcaagcgctga

DBGET integrated database retrieval system