KEGG   Mycobacterium intracellulare ATCC 13950: OCU_42660Help
Entry
OCU_42660         CDS       T02158                                 

Definition
(GenBank) 30S ribosomal protein S11
  KO
K02948  small subunit ribosomal protein S11
Organism
mia  Mycobacterium intracellulare ATCC 13950
Pathway
mia03010  Ribosome
Module
mia_M00178  Ribosome, bacteria
Brite
KEGG Orthology (KO) [BR:mia00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    OCU_42660
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:mia03011]
    OCU_42660
Ribosome [BR:mia03011]
 Ribosomal Proteins
  Mitochondria/ Chloroplast
   Small subunit
    OCU_42660
  Bacteria
    OCU_42660
  Archaea
    OCU_42660
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_S11 ELFV_dehydrog Ribosomal_L18p YtxH
Motif
Other DBs
NCBI-ProteinID: AFC45485
UniProt: H8IQS9
Position
complement(4499054..4499470)
Genome map
AA seq 138 aa AA seqDB search
MPPAKKAASAPKKGQKTRRREKKNVPHGAAHIKSTFNNTIVTITDPQGNVIAWASSGHVG
FKGSRKSTPFAAQLAAENAARKAQEHGVKKVDVFVKGPGSGRETAIRSLQAAGLEVGAIS
DVTPQPHNGVRPPKRRRV
NT seq 417 nt NT seq  +upstreamnt  +downstreamnt
atgccaccagccaagaaggcagcgtccgcccccaagaaggggcagaagacccgtcgccgg
gaaaagaagaacgtcccgcacggcgccgcccacatcaagagcacgttcaacaacacgatc
gtgacgatcaccgacccgcagggcaacgtcatcgcctgggcgtcgtcgggtcacgtcggg
ttcaagggctcgcggaagtcgacgccgttcgccgcgcagctggccgccgagaacgcggcc
cgcaaggcgcaggagcacggcgtcaagaaggtcgacgtgttcgtcaagggaccgggctcg
ggccgggagaccgcgatccggtcgctgcaggccgccggactggaggtcggcgcgatctcc
gacgtcaccccccagccgcacaacggcgttcgccccccgaagcgcagaagggtctag

DBGET integrated database retrieval system