KEGG   Mycobacterium intracellulare ATCC 13950: OCU_42670Help
Entry
OCU_42670         CDS       T02158                                 

Definition
(GenBank) 30S ribosomal protein S13
  KO
K02952  small subunit ribosomal protein S13
Organism
mia  Mycobacterium intracellulare ATCC 13950
Pathway
mia03010  Ribosome
Module
mia_M00178  Ribosome, bacteria
Brite
KEGG Orthology (KO) [BR:mia00001]
 Genetic Information Processing
  Translation
   03010 Ribosome
    OCU_42670
Ribosome [BR:mia03011]
 Ribosomal Proteins
  Bacteria
   Small subunit
    OCU_42670
  Archaea
    OCU_42670
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_S13 FbpA
Motif
Other DBs
NCBI-ProteinID: AFC45486
UniProt: H8IQT0
Position
complement(4499477..4499809)
Genome map
AA seq 110 aa AA seqDB search
MEIALTYIFGVGRTRSNEILEATGIDKNLRTRDLTDDQLTHLRDYIEANLKVEGDLRREV
QADIRRKIEIGCYQGLRHRRGLPVRGQRTKTNARTRKGPKRTIAGKKKAR
NT seq 333 nt NT seq  +upstreamnt  +downstreamnt
atggagatcgcgctgacgtacatcttcggcgtcggccggacccgttcgaacgagattctc
gaagcgaccgggatcgacaagaacctgcgcaccagggacctcaccgacgaccagctgacc
cacctgcgcgactacatcgaagccaacctgaaggtggagggtgacctgcgccgcgaggtc
caggccgacatccgccgcaagatcgagatcggctgctaccagggcctgcggcaccgccgc
ggcctgccggtgcgcggccagcggaccaagaccaacgcgcgcacccgcaagggccccaag
cgcaccatcgccggcaagaagaaggccaggtaa

DBGET integrated database retrieval system