KEGG   Mycobacterium intracellulare ATCC 13950: OCU_42710Help
Entry
OCU_42710         CDS       T02158                                 

Definition
(GenBank) cyclic nucleotide-binding protein
Organism
mia  Mycobacterium intracellulare ATCC 13950
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HATPase_c cNMP_binding HisKA HATPase_c_5
Motif
Other DBs
NCBI-ProteinID: AFC45490
UniProt: H8IQT4
Position
4502311..4503837
Genome map
AA seq 508 aa AA seqDB search
MTGAESIKVPCEPDELRSLFLFEALTDEQLAVLCAAGHIETYEPGPICVEGEPATCFYVL
IEGELMMSKLSGGQDIETNRTSQRGVYCGAWRAFTGGKQKSYDASVHVTRPSRFFVMDAP
VFAQFMRDQFPMAVHLLDGIAVGTDRTRRIIDNREKLLALGRLSAGLTHQLNNPAAAISR
AASDLRERVASMRHKLAMLADGTVSPEALSALVRLQERVAEQVAKSASQHLSALETADRE
DAVGDWLEAHGIDGGWDIAPTFVEGGIDTDWLERISAVSEELASTSAEQAIRWINYTIES
ELLMNQILEASKRISALVADAKQYSQLDRAPFQVTNVHELLRSTLVMFADRLTKDGGKNS
HAIAVVKDFDQSLPEIPCYPGDLNQVWTNIIDNAIAAMRDTGGTLTIRTCREGEHMVRVE
ICDTGPGIPEDVREHIFEPFFTTKPFGEGTGLGLDLAFNIVVKKHRGDLRVESAPGDTRF
IVLLPLQPPAADVAPELDGPEENVTTPE
NT seq 1527 nt NT seq  +upstreamnt  +downstreamnt
atgaccggcgccgaatcgatcaaggtcccctgcgagcccgacgagctgcgcagcctgttt
ttgttcgaggcgctcaccgacgagcagcttgcggtgctgtgcgcggcgggccacatcgaa
acctacgaaccgggcccgatctgcgtcgaaggcgaaccagcgacctgcttctacgtgctg
atcgagggcgagctgatgatgtccaagctctccggcggccaggacatcgagaccaaccgc
acctcgcagcgcggcgtgtactgcggggcctggcgggcgttcaccggcggcaagcagaag
agctacgacgcctcggtgcacgtgacccggccgtcgcggttcttcgtgatggacgcgccg
gtattcgcccaattcatgcgcgaccagttcccgatggccgtccacctgctcgacggcatc
gccgtcggcaccgaccggacccgccgcatcatcgacaaccgggagaagctgctggcgctg
ggccggctgtcggccgggctgacccaccagctcaacaacccggccgcggcgatctcgcgg
gccgcgtcggatctgcgcgaacgggtggccagcatgcggcacaagctggcgatgctcgcc
gacggcaccgtctcccccgaggcgctcagcgccctggtccggctgcaggagagggtcgcc
gagcaggtcgcgaagtccgcctcgcagcatctgagcgcgctggagaccgccgaccgcgag
gacgccgtcggcgactggctggaggcccacggcatcgacggcggctgggacatcgcgccg
acgttcgtcgagggcggcatcgacaccgattggctggagcggatttccgcggtcagcgag
gagctcgcgtcgacatcggcggagcaggcgatccggtggatcaactacaccatcgagagc
gaactgctgatgaaccagatcctcgaagcgagcaaacggatttcggccctggtcgccgac
gccaaacagtattcgcagcttgatcgcgcgccgttccaggtgaccaacgtgcacgagctg
ctgcgcagcacgctggtgatgttcgccgaccggctgaccaaggacggcggcaaaaactcg
cacgccatcgccgtggtcaaggacttcgaccagtcgcttcccgaaatcccttgctatcca
ggtgatctcaatcaagtgtggaccaacatcatcgacaacgcgatcgccgcgatgcgcgat
accggcggcacgctgaccatccgcacctgccgggaaggcgagcacatggtccgcgtcgag
atctgcgacaccggcccgggcatacccgaggacgtgcgcgagcacatcttcgagccgttc
ttcaccaccaagccgttcggcgagggtaccggcctgggcctggatctggcgttcaacatc
gtggtcaagaagcatcgcggggacctgcgggtggaatcggcgcccggcgacacccgattc
atcgtgctgctgccactgcaaccgcccgccgccgacgtcgcccccgaactcgacggcccg
gaagaaaacgtcacgaccccggaatag

DBGET integrated database retrieval system