KEGG   Mycobacterium intracellulare ATCC 13950: OCU_42800Help
Entry
OCU_42800         CDS       T02158                                 

Definition
(GenBank) hypothetical protein
Organism
mia  Mycobacterium intracellulare ATCC 13950
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Copper-bind Cupredoxin_1 PKD
Motif
Other DBs
NCBI-ProteinID: AFC45499
UniProt: H8IQU3
Position
complement(4512241..4512645)
Genome map
AA seq 134 aa AA seqDB search
MGMDIALRRRLLAAVLAASVISSPGCGRPRSVATTPAPTAGVSITAPPPAAGANQVTIDG
FAFAPPNLTVPAGTTVTWTNRDEEPHTVAASDGSFHSPGMGTGATFAHTFSAPGTFDYVC
SIHPMMRGTVVVTG
NT seq 405 nt NT seq  +upstreamnt  +downstreamnt
gtgggcatggatatcgccctgcgtcgaaggcttttggcggccgtgctggccgcgagcgtg
atctcatcgcccggctgtggccggccgcgctccgtggcgaccacccccgcgcccaccgcc
ggggtgtcgatcaccgcgccgccccccgcagccggcgccaaccaggtcaccatcgacggc
ttcgctttcgcgccgccgaacctgacggtgccggccgggaccaccgtcacctggaccaac
cgcgacgaggaaccccatacggtcgccgcaagtgacggctcatttcactcacccggcatg
ggaaccggagcgaccttcgcccacaccttctccgcccctgggactttcgactatgtctgc
tcgattcatccgatgatgcgcggcaccgtggtggtgacgggatga

DBGET integrated database retrieval system