KEGG   Mycobacterium intracellulare ATCC 13950: OCU_42820Help
Entry
OCU_42820         CDS       T02158                                 

Definition
(GenBank) RNA polymerase sigma factor, sigma-70 family protein
  KO
K03088  RNA polymerase sigma-70 factor, ECF subfamily
Organism
mia  Mycobacterium intracellulare ATCC 13950
Brite
KEGG Orthology (KO) [BR:mia00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:mia03021]
    OCU_42820
Transcription machinery [BR:mia03021]
 Prokaryotic type
  Bacterial type
   RNA polymerase
    Sigma factors
     OCU_42820
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sigma70_r4 Sigma70_r4_2 Sigma70_r2 Sigma70_ECF
Motif
Other DBs
NCBI-ProteinID: AFC45501
UniProt: H8IQU5
Position
complement(4513365..4513826)
Genome map
AA seq 153 aa AA seqDB search
MYSDNVGWVYRTLFARVGNRTDAEDLTAEVFLAALRPLRLTVSVAEVRAYLRATARTVLA
AHWRQTLGREITSIEDIEQPADSEEAISTAPQRVARVLDALPDRYRLILESRFLRGNSIK
ESAAELGISVPNAKVLQHRALRLAAQVNDGGKQ
NT seq 462 nt NT seq  +upstreamnt  +downstreamnt
gtgtactccgacaacgtggggtgggtgtaccgcacgctgttcgcgcgcgtcggcaaccgg
accgacgccgaagacctcaccgccgaggtgttcctcgccgcgctgcggccgctgcgcctg
accgtgagcgtggccgaggtgcgcgcctacctgcgggccacggccaggacggtgctggcc
gcacactggcgccagaccctgggacgggagatcacctcgatcgaggacatcgagcaaccg
gccgacagcgaggaggcgatcagcaccgcgccgcagcgggtggcccgcgtcctggacgcc
ctgccggatcggtatcgcctgatcctggaatcgcgctttctgcgcggcaattcgatcaag
gagtcggccgcggaactcggaatcagcgtgcccaatgccaaagtgctccagcaccgcgcc
ctgcggctggcggcgcaggtcaacgatgggggcaagcaatga

DBGET integrated database retrieval system